PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g38820.1
Common NameLOC4349212, Os10g0531900, OSJNBa0053C23.13, OSNPB_100531900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 401aa    MW: 43174.2 Da    PI: 7.286
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g38820.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.71.4e-09248305562
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                       kr +r   NR +A rs +R+  +i+eLe+kv+ L++e ++L  +l  l+  ++ + ++
  LOC_Os10g38820.1 248 KRVKRVLANRQSAARSKERRMRYIAELEQKVQILQTEATTLSAQLTLLQRDSSGMATQ 305
                       999******************************************9999887766665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.0E-16244308IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.565246309IPR004827Basic-leucine zipper domain
PfamPF001703.5E-9248306IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.7E-9248303No hitNo description
SuperFamilySSF579591.34E-10248298No hitNo description
CDDcd147032.27E-21249298No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009037anatomylemma
PO:0001047developmental stagelemma development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MNTTSANELM MHRHVQAAPY AAAPQQQGGK QRAPGLPPTP PPPPAAASSH SSHGDVCMDD  60
TARGGLLPPR KAHRRSRSDV PFGYFQPLPP PSPKMEAGGG WALPGCGGAG DVDLLNAYMS  120
LEGMGGADGL NNSDGDSRGS SMRTNGADSS ENESEDYVGA DSQALLWGGA GGGEAAGKKR  180
RNNAAGEKAA RHARSLSMDS LMGKLSFAAN GEPAKFSLEF GSGEFTPAEM KRIMADEKLA  240
EMALADPKRV KRVLANRQSA ARSKERRMRY IAELEQKVQI LQTEATTLSA QLTLLQRDSS  300
GMATQNNELK FRLQSMEQQA QLRDALNEAL TAEVQRLKLA ANEVCDTSSS SNLAHQIQLR  360
CQNQMLDLHK QQQQQVEQIP FYQLELPEQQ NGTARNHESK *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.468360.0leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329938160.0
Expression AtlasQ8LN44-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g38820.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g38820
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1086070.0AK108607.1 Oryza sativa Japonica Group cDNA clone:002-146-H05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613793.10.0PREDICTED: transcription factor RF2a-like
TrEMBLQ8LN440.0Q8LN44_ORYSJ; BZIP transcription factor family protein, expressed
STRINGLOC_Os10g38820.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12617181
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.37e-65bZIP family protein