PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g37240.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Trihelix
Protein Properties Length: 861aa    MW: 88757 Da    PI: 5.7061
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g37240.4genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix99.23.6e-31197281187
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                       rW++qe+laL+++r++m+ ++r++ lk+plWeevs+k++e+g++rs+k+Ckek+en++k+yk++ke++ +r  ++ +t+++f+qlea
  LOC_Os10g37240.4 197 RWPRQETLALLKIRSDMDAAFRDATLKGPLWEEVSRKLAEEGYRRSAKKCKEKFENVHKYYKRTKESRAGR--NDGKTYRFFTQLEA 281
                       8********************************************************************97..56668*******85 PP

2trihelix111.16.8e-35548633187
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                       rW+k ev+aLi++r+++++r++++  k+plWee+s+ mr+ g++rs+k+Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+ql+a
  LOC_Os10g37240.4 548 RWPKAEVHALIQLRSNLDNRYQEAGPKGPLWEEISAGMRRLGYSRSSKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYFHQLDA 633
                       8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.0034194256IPR001005SANT/Myb domain
PfamPF138373.0E-21196282No hitNo description
CDDcd122031.73E-29196261No hitNo description
PROSITE profilePS500906.737196254IPR017877Myb-like domain
SMARTSM007170.0087545607IPR001005SANT/Myb domain
PROSITE profilePS500907.317547605IPR017877Myb-like domain
PfamPF138379.4E-24547634No hitNo description
Gene3DG3DSA:1.10.10.604.7E-4547604IPR009057Homeodomain-like
CDDcd122034.69E-30548612No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 861 aa     Download sequence    Send to blast
MAIYYLEREG LTHNMPMHGH FYTPLPLNHW HADTTNAADM TRGPMRMWAP HVSGMNFIFF  60
ISKEKVLMRV EMVSSPDVLI IPSPPFPSGN TRGGGGGGGG SSMQQQQPGG GGGGVQQFGA  120
VAPEMSPFSP AGGGGGGRIS MAEAASPISS RPPPAQQQFD ELGVGGGGGG GGGFDAEALA  180
AAAVGEEGAS GGAGGNRWPR QETLALLKIR SDMDAAFRDA TLKGPLWEEV SRKLAEEGYR  240
RSAKKCKEKF ENVHKYYKRT KESRAGRNDG KTYRFFTQLE ALHGTAAGVV AAPSPVTSLA  300
PPPATAVGVS GGVRAPAEPP PAVVMGNVMS FSTSNTEEYS DEEDSDDEGT EDMGGGGGDE  360
RGKRKRLSEG GAAAGVGDGA AGGDAAAVSG GHREAGAGPD DPRGGVAAAG DARLAREQEI  420
PAGARHVGDA AVVSFIQKIT GQTIPMPPII AAPAITVMPP PAPSQQPQPP PPPSHPTPIT  480
SVAPAPPPPP PAAAAAAASQ PSPQATKSPL PATPQTQSSM DIVMTAAEAH DAGYDGSGGG  540
GGQPSSSRWP KAEVHALIQL RSNLDNRYQE AGPKGPLWEE ISAGMRRLGY SRSSKRCKEK  600
WENINKYFKK VKESNKKRPE DSKTCPYFHQ LDALYRNKAA LNSSSSSAAA AAPALPPPEH  660
AEPAVTVAAP ISQTPPPPPP QPVTTTKNGN GTSSTNGANG EGGGGGSGGM QMQASNGSVV  720
AGNKFFTGAA AKKPEDIMKE MMEQRPQQPA AANNAFNRTD GGGGGGGVDS DNMDEDDEDD  780
YDDDDDDDDD DVDGNKMQYE IQFQHQHHHQ QPPQHRHQQS VVRPNAAASA AAGGNPPGTA  840
APATAAAATT TTGSFLAMVQ *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
187100SGNTRGGGGGGGGS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.883490.0flower| leaf| panicle| root| seed| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g37240.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g37240
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8305450.0CT830545.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA218F06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001167728.10.0uncharacterized protein LOC100381416
RefseqXP_008643912.10.0PREDICTED: hypothetical protein isoform X1
RefseqXP_008643913.10.0PREDICTED: hypothetical protein isoform X1
TrEMBLA0A0E0R1E30.0A0A0E0R1E3_ORYRU; Uncharacterized protein
STRINGLOC_Os10g37240.40.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
MonocotsOGMP60638175
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.13e-49Trihelix family protein