PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g37240.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Trihelix
Protein Properties Length: 342aa    MW: 35912 Da    PI: 5.2168
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g37240.3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix113.11.6e-3529114187
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                       rW+k ev+aLi++r+++++r++++  k+plWee+s+ mr+ g++rs+k+Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+ql+a
  LOC_Os10g37240.3  29 RWPKAEVHALIQLRSNLDNRYQEAGPKGPLWEEISAGMRRLGYSRSSKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYFHQLDA 114
                       8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.00872688IPR001005SANT/Myb domain
PfamPF138372.2E-2428115No hitNo description
Gene3DG3DSA:1.10.10.601.3E-42885IPR009057Homeodomain-like
PROSITE profilePS500907.3172886IPR017877Myb-like domain
CDDcd122031.26E-282993No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MDIVMTAAEA HDAGYDGSGG GGGQPSSSRW PKAEVHALIQ LRSNLDNRYQ EAGPKGPLWE  60
EISAGMRRLG YSRSSKRCKE KWENINKYFK KVKESNKKRP EDSKTCPYFH QLDALYRNKA  120
ALNSSSSSAA AAAPALPPPE HAEPAVTVAA PISQTPPPPP PQPVTTTKNG NGTSSTNGAN  180
GEGGGGGSGG MQMQASNGSV VAGNKFFTGA AAKKPEDIMK EMMEQRPQQP AAANNAFNRT  240
DGGGGGGGVD SDNMDEDDED DYDDDDDDDD DDVDGNKMQY EIQFQHQHHH QQPPQHRHQQ  300
SVVRPNAAAS AAAGGNPPGT AAPATAAAAT TTTGSFLAMV Q*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.883490.0flower| leaf| panicle| root| seed| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g37240.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g37240
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8305450.0CT830545.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA218F06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012698336.12e-90PREDICTED: LOW QUALITY PROTEIN: trihelix transcription factor GTL1
TrEMBLQ0IWD71e-177Q0IWD7_ORYSJ; Os10g0516500 protein (Fragment)
STRINGBGIOSGA031553-PA1e-127(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.12e-52Trihelix family protein