PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g37240.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Trihelix
Protein Properties Length: 597aa    MW: 61982.4 Da    PI: 6.2885
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g37240.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix44.63.9e-147553787
          trihelix 37 kmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87
                      k++e+g++rs+k+Ckek+en++k+yk++ke++ +r  ++ +t+++f+qlea
  LOC_Os10g37240.2  7 KLAEEGYRRSAKKCKEKFENVHKYYKRTKESRAGR--NDGKTYRFFTQLEA 55
                      5689*****************************97..56668*******85 PP

2trihelix111.84.1e-35284369187
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                       rW+k ev+aLi++r+++++r++++  k+plWee+s+ mr+ g++rs+k+Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+ql+a
  LOC_Os10g37240.2 284 RWPKAEVHALIQLRSNLDNRYQEAGPKGPLWEEISAGMRRLGYSRSSKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYFHQLDA 369
                       8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138373.5E-9756No hitNo description
SMARTSM007170.0087281343IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-4283340IPR009057Homeodomain-like
PfamPF138375.6E-24283370No hitNo description
PROSITE profilePS500907.317283341IPR017877Myb-like domain
CDDcd122033.21E-29284348No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 597 aa     Download sequence    Send to blast
MHATFLKLAE EGYRRSAKKC KEKFENVHKY YKRTKESRAG RNDGKTYRFF TQLEALHGTA  60
AGVVAAPSPV TSLAPPPATA VGVSGGVRAP AEPPPAVVMG NVMSFSTSNT EEYSDEEDSD  120
DEGTEDMGGG GGDERGKRKR LSEGGAAAGV GGGGGGGGGS GKMMRFFEGL MKQKITGQTI  180
PMPPIIAAPA ITVMPPPAPS QQPQPPPPPS HPTPITSVAP APPPPPPAAA AAAASQPSPQ  240
ATKSPLPATP QTQSSMDIVM TAAEAHDAGY DGSGGGGGQP SSSRWPKAEV HALIQLRSNL  300
DNRYQEAGPK GPLWEEISAG MRRLGYSRSS KRCKEKWENI NKYFKKVKES NKKRPEDSKT  360
CPYFHQLDAL YRNKAALNSS SSSAAAAAPA LPPPEHAEPA VTVAAPISQT PPPPPPQPVT  420
TTKNGNGTSS TNGANGEGGG GGSGGMQMQA SNGSVVAGNK FFTGAAAKKP EDIMKEMMEQ  480
RPQQPAAANN AFNRTDGGGG GGGVDSDNMD EDDEDDYDDD DDDDDDDVDG NKMQYEIQFQ  540
HQHHHQQPPQ HRHQQSVVRP NAAASAAAGG NPPGTAAPAT AAAATTTTGS FLAMVQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.883490.0flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ7XCT3
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g37240.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g37240
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8305450.0CT830545.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA218F06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001167728.11e-136uncharacterized protein LOC100381416
RefseqXP_008643912.11e-136PREDICTED: hypothetical protein isoform X1
RefseqXP_008643913.11e-136PREDICTED: hypothetical protein isoform X1
TrEMBLQ7XCT30.0Q7XCT3_ORYSJ; Expressed protein
STRINGLOC_Os10g37240.40.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.11e-50Trihelix family protein