PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g36420.1
Common NameLOC4349074, Os10g0508300, OSJNBb0015K05.5, OSJNBb0091N21.48, YAB3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family YABBY
Protein Properties Length: 314aa    MW: 32860.3 Da    PI: 8.4004
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g36420.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY775.8e-2454105455
             YABBY   4 fssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasq 55 
                       +s  eq+Cyv+C +C+t+l+vsvPs+slf++vtvrCGhC+sll+vn++    
  LOC_Os10g36420.1  54 DSEQEQLCYVHCHYCDTVLVVSVPSSSLFETVTVRCGHCSSLLTVNMRGLLL 105
                       56789***************************************99987664 PP

2YABBY131.61e-40200267105170
             YABBY 105 edeevprvpp..virPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                        +e +pr+    ++rPPekrqrvPsaynrfik+eiqrika+nPdishreafsaaaknWahfP+ihfgl
  LOC_Os10g36420.1 200 AKEPSPRTNTavINRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL 267
                       44555665544489****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046902.2E-2356107IPR006780YABBY protein
PfamPF046904.8E-39199267IPR006780YABBY protein
SuperFamilySSF470958.12E-8209260IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.103.8E-4216259IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MSSSSSSSAS SAAAAAFRPA VVQREQQVVE EKFPAAAAAM REMVLPPVAA AAADSEQEQL  60
CYVHCHYCDT VLVVSVPSSS LFETVTVRCG HCSSLLTVNM RGLLLPTTAA AAPPPPPPPP  120
PPPPPPAAHF PHSLNLAPAN PPHHHSLLDE ISTANSPTQL LLEQHGLGGL MASAASCRNN  180
NSPAAAAAPP PPTSQGKAAA KEPSPRTNTA VINRPPEKRQ RVPSAYNRFI KDEIQRIKAG  240
NPDISHREAF SAAAKNWAHF PHIHFGLMPD HQGLKKTSLL PQDHQRKDGL LKEGLYAAAA  300
AAAAAANMGV APY*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.589660.0flower| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1242710310.0
Expression AtlasQ8L556-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in shoot apex and young inflorescences. {ECO:0000269|PubMed:17216490}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g36420.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g36420
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2740150.0AB274015.1 Oryza sativa Japonica Group OsYABBY3 mRNA for OsYABBY3 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613818.10.0PREDICTED: protein YABBY 3
SwissprotQ8L5560.0YAB3_ORYSJ; Protein YABBY 3
TrEMBLA0A0E0R1690.0A0A0E0R169_ORYRU; Uncharacterized protein
STRINGLOC_Os10g36420.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1300345
MonocotsOGMP144538121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45190.12e-44YABBY family protein
Publications ? help Back to Top
  1. Toriba T, et al.
    Molecular characterization the YABBY gene family in Oryza sativa and expression analysis of OsYABBY1.
    Mol. Genet. Genomics, 2007. 277(5): p. 457-68
    [PMID:17216490]