PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g35660.1
Common NameOSJNBa0078O01.21
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 295aa    MW: 31656.6 Da    PI: 5.0442
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g35660.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.82.5e-13351148
                      TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                      +g+W++eEd+l+++  +++G g +W + +  +g+ R++ +c+srw++yl
  LOC_Os10g35660.1  3 KGKWSKEEDDLIKNHMEKYGIGrSWQALSDALGLQRCGRSCRSRWLNYL 51
                      79******************999************************97 PP

2Myb_DNA-binding32.61.8e-1058101247
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       g +++ E+ ++ +   + G+  W++Ia+ ++ gRt+  +k++w++ 
  LOC_Os10g35660.1  58 GDFSPAEERIICKMYSKKGSS-WSAIAAQLP-GRTDLAVKNYWNST 101
                       679****************99.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.125155IPR017930Myb domain
SuperFamilySSF466891.29E-24298IPR009057Homeodomain-like
SMARTSM007172.4E-10253IPR001005SANT/Myb domain
PfamPF002496.2E-12351IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-19458IPR009057Homeodomain-like
CDDcd001673.86E-9551No hitNo description
PROSITE profilePS5129414.57856106IPR017930Myb domain
SMARTSM007176.4E-1156104IPR001005SANT/Myb domain
PfamPF002491.2E-958101IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-2059105IPR009057Homeodomain-like
CDDcd001679.32E-860102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MKKGKWSKEE DDLIKNHMEK YGIGRSWQAL SDALGLQRCG RSCRSRWLNY LRPGLKHGDF  60
SPAEERIICK MYSKKGSSWS AIAAQLPGRT DLAVKNYWNS TLKKRFPAAA AARSTAAARR  120
RHRPAASATT SSDDDDDVDV DDATPPGLAL VVYSEGSTAA AAAAGELAPY SISSPAATAD  180
AAEEEEPIAA VPISTCILAL PPPPPPPPPP PSDATGGEVS IPCFPFSPLP FIEPDLPELT  240
WTTDLDDITA TFDAAACRYP KRPHPITPDS PRLPKLPAIA GFDDVQSFLS WFDD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-23110625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ8LNG8
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g35660.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g35660
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0798880.0AC079888.10 Oryza sativa chromosome 10 BAC OSJNBa0078O01 genomic sequence, complete sequence.
GenBankAP0149660.0AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA2Z9110.0A2Z911_ORYSI; Uncharacterized protein
TrEMBLQ8LNG80.0Q8LNG8_ORYSJ; Myb-like DNA-binding domain containing protein
STRINGBGIOSGA031610-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os10g35660.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP122282638
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37780.15e-41myb domain protein 87