PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g35300.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Dof
Protein Properties Length: 274aa    MW: 27667 Da    PI: 8.4778
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g35300.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof104.27.6e-33103159561
            zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                        ++cprC s+ntkfCyynnys +qPry+CkaCrr+Wt+GG+lr+vPvGggr+++k++
  LOC_Os10g35300.2 103 PRQCPRCGSANTKFCYYNNYSRTQPRYLCKACRRHWTEGGTLRDVPVGGGRKNSKRA 159
                       679***********************************************9998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.1E-30104158IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.468104158IPR003851Zinc finger, Dof-type
PROSITE patternPS013610106142IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-16111149IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MSSPFLGSSS SSASSPLSYL TPPRPPPPPP PLLMVRHGLA RWLTDLDDEL MVFDDDLGVQ  60
GQGYAAAANG GIGGGGVEAV NAAAAPRQGG RHAGHPPLPR PPPRQCPRCG SANTKFCYYN  120
NYSRTQPRYL CKACRRHWTE GGTLRDVPVG GGRKNSKRAA GGGKAGATAS TAASAHVVAP  180
AAAPPTSSSF PDLLRQMLMA PATAGGGGGY SIDLTAWQQM AAFAAPPQAA TGDVGGAVGA  240
ASTAAPDANC GGGGVQYWNG WLQDDMPGLD GSC*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.559860.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166339340.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g35300.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g35300
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0924890.0AC092489.4 Oryza sativa chromosome 10 BAC OSJNBa0066I08 genomic sequence, complete sequence.
GenBankAP0149660.0AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015614315.16e-88PREDICTED: dof zinc finger protein DOF3.1
TrEMBLA0A0D3HF610.0A0A0D3HF61_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0R0W40.0A0A0E0R0W4_ORYRU; Uncharacterized protein
STRINGLOC_Os10g35300.20.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.31e-17Dof family protein