PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g35300.1
Common NameLOC4349003, Os10g0496000, OSNPB_100496000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Dof
Protein Properties Length: 248aa    MW: 24655.6 Da    PI: 9.4789
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g35300.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof104.46.4e-3377133561
            zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                        ++cprC s+ntkfCyynnys +qPry+CkaCrr+Wt+GG+lr+vPvGggr+++k++
  LOC_Os10g35300.1  77 PRQCPRCGSANTKFCYYNNYSRTQPRYLCKACRRHWTEGGTLRDVPVGGGRKNSKRA 133
                       679***********************************************9998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088426.46878132IPR003851Zinc finger, Dof-type
PfamPF027012.6E-3078132IPR003851Zinc finger, Dof-type
PROSITE patternPS01361080116IPR003851Zinc finger, Dof-type
ProDomPD0074789.0E-1785123IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MSSPFLGSSS SSASSPLSYL TPPRPPPPPP PLLMGQGYAA AANGGIGGGG VEAVNAAAAP  60
RQGGRHAGHP PLPRPPPRQC PRCGSANTKF CYYNNYSRTQ PRYLCKACRR HWTEGGTLRD  120
VPVGGGRKNS KRAAGGGKAG ATASTAASAH VVAPAAAPPT SSSFPDLLRQ MLMAPATAGG  180
GGGYSIDLTA WQQMAAFAAP PQAATGDVGG AVGAASTAAP DANCGGGGVQ YWNGWLQDDM  240
PGLDGSC*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.559860.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166339340.0
Expression AtlasQ7G2G1-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g35300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g35300
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1090910.0AK109091.1 Oryza sativa Japonica Group cDNA clone:002-155-A04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015614315.11e-175PREDICTED: dof zinc finger protein DOF3.1
TrEMBLQ7G2G11e-175Q7G2G1_ORYSJ; Dof domain, zinc finger family protein, expressed
STRINGBGIOSGA031626-PA1e-174(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.39e-18Dof family protein