PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g33810.1
Common NameLOC4348906, Os10g0478300, OSJNBa0055P24.4, OSNPB_100478300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 277aa    MW: 30064.7 Da    PI: 7.9372
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g33810.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.92.3e-181461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+W++eEd++lv +++++G ++W++ ++  g+ R++k+c++rw +yl
  LOC_Os10g33810.1 14 RGAWSPEEDDRLVAYIRRHGHPNWRALPKQAGLLRCGKSCRLRWINYL 61
                      89******************************99************97 PP

2Myb_DNA-binding53.36.3e-1767112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++T++E++l+v++++ lG++ W++Ia+ m+ gRt++++k+ w+++l
  LOC_Os10g33810.1  67 RGNFTADEEDLIVRLHNSLGNR-WSAIAAQMP-GRTDNEIKNVWHTHL 112
                       89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.091961IPR017930Myb domain
SuperFamilySSF466893.26E-2911108IPR009057Homeodomain-like
SMARTSM007177.1E-131363IPR001005SANT/Myb domain
PfamPF002496.9E-161461IPR001005SANT/Myb domain
CDDcd001673.60E-101661No hitNo description
PROSITE profilePS5129424.60762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.9E-2665116IPR009057Homeodomain-like
SMARTSM007172.6E-1466114IPR001005SANT/Myb domain
PfamPF002493.5E-1567112IPR001005SANT/Myb domain
CDDcd001673.12E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020104anatomyleaf sheath
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MGRAPCCEKE GLRRGAWSPE EDDRLVAYIR RHGHPNWRAL PKQAGLLRCG KSCRLRWINY  60
LRPDIKRGNF TADEEDLIVR LHNSLGNRWS AIAAQMPGRT DNEIKNVWHT HLKKRLDDER  120
KLAAAGGGGG RRPHTRKQPK AAKSAAAVKR EATPSVSVDT SSGVTCSTVT ESSPSSADGD  180
HRRQQQQTQH AAVKEESFSS GGELPAAAAA PTAAADMDES FWSSTEVTGM MAGLGDMDEE  240
LAIAGTSSAA AARSDDMEFW LKMLLESGDM RDLAVL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-25121175109B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.33870.0leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166364120.0
Expression AtlasQ7XDC7-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g33810.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g33810
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1090110.0AK109011.1 Oryza sativa Japonica Group cDNA clone:002-153-H11, full insert sequence.
GenBankY113500.0Y11350.1 O.sativa mRNA for myb factor, 1084 bp.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612956.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLO041080.0O04108_ORYSA; Myb factor
TrEMBLQ7XDC70.0Q7XDC7_ORYSJ; Myb factor
STRINGLOC_Os10g33810.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.12e-74myb domain protein 15