PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g33760.1
Common NameLOC4348901, Os10g0477600, OSJNBa0026O12.6, OSNPB_100477600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 325aa    MW: 35637 Da    PI: 5.6091
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g33760.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.65.9e-50111391129
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrF P+deel+++yL++kv+++++    ++ +vd++  ePw+Lp+ +k + +ewyfFs rd+kyatg+r+nratk+gyWkatgkd+ v+
  LOC_Os10g33760.1  11 LPPGFRFCPSDEELICFYLRNKVANHRVAS-GTLVDVDLHAREPWELPEVAKLTAEEWYFFSFRDRKYATGSRTNRATKTGYWKATGKDRIVH 102
                       79*************************888.88***************87788899**********************************999 PP

               NAM  94 sk.kgelvglkktLvfykgrapkgektdWvmheyrle 129
                       +  ++++vg++ktLvfy grap+g+kt+Wvmhe+rle
  LOC_Os10g33760.1 103 EGtTRAVVGMRKTLVFYLGRAPNGQKTTWVMHEFRLE 139
                       9766778***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-598157IPR003441NAC domain
PROSITE profilePS5100557.42411157IPR003441NAC domain
PfamPF023659.2E-2812138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MAGLREMEST LPPGFRFCPS DEELICFYLR NKVANHRVAS GTLVDVDLHA REPWELPEVA  60
KLTAEEWYFF SFRDRKYATG SRTNRATKTG YWKATGKDRI VHEGTTRAVV GMRKTLVFYL  120
GRAPNGQKTT WVMHEFRLET PNSQPKEDWV LCRVFDKKKP STIEAEGGGS SGSDLFIPGA  180
TDGSTDPSSP TTMAPLLGSS PDPTVVDRFD HRSAAVPPLM VLMQGGGDQM ISGSGVHCSN  240
NDNSGSSSAL LNLTMLQYSF LEHRPTGDDM AVGAHFGTCQ GGNNDATMAL GMGFEEHGMG  300
EIIEMEPAWR QGGSNCVYRD ELYF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-491015816166NO APICAL MERISTEM PROTEIN
1ut4_B5e-491015816166NO APICAL MERISTEM PROTEIN
1ut7_A5e-491015816166NO APICAL MERISTEM PROTEIN
1ut7_B5e-491015816166NO APICAL MERISTEM PROTEIN
3swm_A6e-491015819169NAC domain-containing protein 19
3swm_B6e-491015819169NAC domain-containing protein 19
3swm_C6e-491015819169NAC domain-containing protein 19
3swm_D6e-491015819169NAC domain-containing protein 19
3swp_A6e-491015819169NAC domain-containing protein 19
3swp_B6e-491015819169NAC domain-containing protein 19
3swp_C6e-491015819169NAC domain-containing protein 19
3swp_D6e-491015819169NAC domain-containing protein 19
4dul_A5e-491015816166NAC domain-containing protein 19
4dul_B5e-491015816166NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.391290.0callus| leaf| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166363690.0
Expression AtlasQ9AV06-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g33760.1
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g33760
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1195580.0AK119558.1 Oryza sativa Japonica Group cDNA clone:002-106-A07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613250.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 1
SwissprotQ84TE62e-60NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLQ9AV060.0Q9AV06_ORYSJ; NAC-domain containing protein 21/22, putative, expressed
STRINGLOC_Os10g33760.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP69738166
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.12e-76NAC domain containing protein 74