PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g32600.1
Common NameEHD1, LOC107276289, Os10g0463400, OsJ_31808, OSJNBa0071K18.25, RR30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 168aa    MW: 18684.4 Da    PI: 9.6095
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g32600.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like751.1e-23110159151
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                       k rl Wt++LH++F+ av++L G++kA+Pk+il +mkvk Lt+e+v+SHLQ
  LOC_Os10g32600.1 110 KSRLTWTTQLHRQFIAAVNHL-GEDKAVPKKILGIMKVKHLTREQVASHLQ 159
                       68*******************.***************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23002.6E-8157No hitNo description
PROSITE profilePS5011013.274139IPR001789Signal transduction response regulator, receiver domain
SuperFamilySSF521722.78E-7356IPR011006CheY-like superfamily
PROSITE profilePS5129412.906107166IPR017930Myb domain
SuperFamilySSF466894.12E-15109160IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-22110161IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.0E-22110159IPR009057Homeodomain-like
PfamPF002492.8E-6112160IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009736Biological Processcytokinin-activated signaling pathway
GO:0009908Biological Processflower development
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MASSGDTNTV MKYVANGAFD FLLKPVRIEE LSNIWQHIFR KQMQDHKNNN MVGNLEKPGH  60
PPSILAMARA TPATTRSTAT EASLAPLENE VRDDMVNYNG EITDIRDLGK SRLTWTTQLH  120
RQFIAAVNHL GEDKAVPKKI LGIMKVKHLT REQVASHLQV ILNTGCN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-15110159554ARR10-B
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ7Y0W5
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that acts as floral inducer to promote short-day (SD) flowering pathway. Activates HD3A and other FT-like genes independently from HD1. May also activate MADS-box transcription factors involved in flowering regulation (PubMed:15078816). Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins (By similarity). {ECO:0000250|UniProtKB:Q940D0, ECO:0000269|PubMed:15078816}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g32600.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Daily oscillation and diurnal expression in plants grown in short days (SD) but not in long days (LD) conditions. {ECO:0000269|PubMed:15078816}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g32600
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN5943980.0JN594398.1 Oryza rufipogon isolate R-Tw3 Ehd1 (Ehd1) gene, partial cds.
GenBankJN5943870.0JN594387.1 Oryza rufipogon isolate R-Chi3 Ehd1 (Ehd1) gene, partial cds.
GenBankJN5943770.0JN594377.1 Oryza sativa Japonica Group isolate LJ-Vie Ehd1 (Ehd1) gene, partial cds.
GenBankJN5943420.0JN594342.1 Oryza sativa Japonica Group isolate CJ-Nipponbare Ehd1 (Ehd1) gene, partial cds.
GenBankJN4021700.0JN402170.1 Oryza rufipogon isolate H14 B-type response regulator (Ehd1) gene, partial cds.
GenBankJN4021570.0JN402157.1 Oryza rufipogon x Oryza sativa isolate H1 B-type response regulator (Ehd1) gene, partial cds.
GenBankAC0270380.0AC027038.12 Oryza sativa chromosome 10 BAC OSJNBa0071K18 genomic sequence, complete sequence.
GenBankAB4779880.0AB477988.1 Oryza sativa Japonica Group Ehd1 gene for B-type response regulator, complete cds, allele: ef1-h.
GenBankAP0149660.0AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
GenBankAB0925060.0AB092506.1 Oryza sativa Japonica Group Ehd1 gene for B-type response regulator, complete cds, cultivar:Nipponbare.
GenBankKC6092510.0KC609251.1 Oryza sativa Japonica Group early heading date 1 (Ehd1) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613931.11e-114PREDICTED: two-component response regulator ORR30 isoform X1
RefseqXP_015613932.11e-114PREDICTED: two-component response regulator ORR30 isoform X1
RefseqXP_015613933.11e-114PREDICTED: two-component response regulator ORR30 isoform X1
SwissprotQ7Y0W51e-116ORR30_ORYSJ; Two-component response regulator ORR30
TrEMBLG3LIW41e-117G3LIW4_9ORYZ; B-type response regulator (Fragment)
TrEMBLG3LIW81e-117G3LIW8_ORYSA; B-type response regulator (Fragment)
TrEMBLG3LIX41e-117G3LIX4_ORYRU; B-type response regulator (Fragment)
STRINGLOC_Os10g32600.11e-116(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1705633
MonocotsOGMP112222741
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.12e-28response regulator 2
Publications ? help Back to Top
  1. Doi K, et al.
    Ehd1, a B-type response regulator in rice, confers short-day promotion of flowering and controls FT-like gene expression independently of Hd1.
    Genes Dev., 2004. 18(8): p. 926-36
    [PMID:15078816]
  2. Schaller GE, et al.
    Nomenclature for two-component signaling elements of rice.
    Plant Physiol., 2007. 143(2): p. 555-7
    [PMID:17284581]