PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g32070.1
Common NameLOC107276516, OsJ_31787, OSJNBb0011A08.7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GATA
Protein Properties Length: 529aa    MW: 57300.9 Da    PI: 7.9149
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g32070.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.15.8e-196598134
              GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
                      C++Cgtt+Tp+WR+gp+g++tLCnaC ++yr+ +
  LOC_Os10g32070.1 65 CRHCGTTETPQWRHGPEGHRTLCNACSMRYRSGK 98
                      *******************************976 PP

2GATA49.84.6e-16237270134
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                       C++CgttkTp WR gpd  ++LCnaCG +yr+  
  LOC_Os10g32070.1 237 CAHCGTTKTPAWRLGPDSRRKLCNACGNKYRSGQ 270
                       *******************************976 PP

3GATA47.62.2e-15455489135
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                       C++CgttkTp W +gpd   +LCnaCG  yrk +l
  LOC_Os10g32070.1 455 CTHCGTTKTPAWLSGPDSRGKLCNACGKQYRKGRL 489
                       ********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577161.14E-1457120No hitNo description
PROSITE profilePS5011412.7565995IPR000679Zinc finger, GATA-type
SMARTSM004011.4E-1659113IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.106.7E-146397IPR013088Zinc finger, NHR/GATA-type
CDDcd002028.30E-1464113No hitNo description
PfamPF003202.3E-166598IPR000679Zinc finger, GATA-type
SuperFamilySSF577167.6E-11230271No hitNo description
Gene3DG3DSA:3.30.50.101.7E-12231286IPR013088Zinc finger, NHR/GATA-type
SMARTSM004017.4E-9231288IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.558231267IPR000679Zinc finger, GATA-type
CDDcd002024.05E-9236268No hitNo description
PfamPF003202.3E-14237270IPR000679Zinc finger, GATA-type
PROSITE profilePS501148.814387406IPR000679Zinc finger, GATA-type
SMARTSM004010.15387433IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.8E-4392406IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577161.09E-11447510No hitNo description
SMARTSM004017.4E-9449503IPR000679Zinc finger, GATA-type
PROSITE profilePS5011410.224449485IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.9E-10453487IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.57E-10454503No hitNo description
PfamPF003201.6E-13455489IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 529 aa     Download sequence    Send to blast
MVVVDGLHDG GGGDLQALLD DAGVDDVAAR GGGEVEEEVE RPSNEDAFPA VEKMATAAAA  60
KGLQCRHCGT TETPQWRHGP EGHRTLCNAC SMRYRSGKLV PEYRPLRSPT FSPELHSNRH  120
HRVLQLRRRP GPQSAAPSPA AVARYGGEAK EEEEELAWVS NKDAFATVET TMAPSPRVVE  180
TPPEHDHRPA NTPTTSPEPH SDRPRRVVQL PRRLQEPSAS ANLAHAVAAT ARAGRECAHC  240
GTTKTPAWRL GPDSRRKLCN ACGNKYRSGQ LNSTTFSQNS QEQKKKSKSS ACSRERKRSA  300
VAATVVVGGG LRDDAAAIAD EHLDGGDLQA LLDDVALDDV AARGGGDAGE AKEEEEELEW  360
LSNKDAFPTV ETMSPAPPEN RTKAPVPPAG WQCRHCGSTE TPLWRERDGP AEAEHVRKEE  420
TPPNITPATK HRRIVDLLRC STALNTAAKA VERRCTHCGT TKTPAWLSGP DSRGKLCNAC  480
GKQYRKGRLV PEYRPLNCPT FSPELHSNAH AHRRRRESPV AIAIAGEK*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ94LT1
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g32070.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g32070
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0967810.0AC096781.6 Oryza sativa chromosome 10 BAC OSJNBa0013H08 genomic sequence, complete sequence.
GenBankAC0342580.0AC034258.10 Oryza sativa chromosome 10 BAC OSJNBb0011A08 genomic sequence, complete sequence.
GenBankAP0149660.0AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613898.10.0PREDICTED: siderophore biosynthesis regulatory protein URBS1-like
TrEMBLQ94LT10.0Q94LT1_ORYSJ; GATA zinc finger family protein
STRINGLOC_Os10g32070.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
MonocotsOGMP157091414
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.12e-24GATA transcription factor 1