PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g26620.1
Common NameOSJNBa0060A14.11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Dof
Protein Properties Length: 438aa    MW: 46135.4 Da    PI: 8.1996
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g26620.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.66.6e-3991150261
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                       ++k+l+cprC s++tkfCy+nny+++qPr+fCk C+ryWt+GGa+rnvPvG+grrknk++
  LOC_Os10g26620.1  91 PDKILPCPRCSSMDTKFCYFNNYNVNQPRHFCKHCQRYWTAGGAMRNVPVGAGRRKNKNA 150
                       7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-3878148IPR003851Zinc finger, Dof-type
PfamPF027011.3E-3193149IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.57495149IPR003851Zinc finger, Dof-type
PROSITE patternPS01361097133IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MGECRGGGGG GDGLIKLFGK TIPVQPDAKD VQQHSGSSSS STESDVQETA AVAVADPSPR  60
SEVVDGESPP QPGGEAASHQ QQQKEMKLKK PDKILPCPRC SSMDTKFCYF NNYNVNQPRH  120
FCKHCQRYWT AGGAMRNVPV GAGRRKNKNA TAAAHFLHRV RACAAAAAMP AAPHDATNAT  180
VLSFGGGGGG HDAPPVTLDL ADKMTRLGKE GLVAHARNAD AAAACSEVSS NRDDEQIGNT  240
VAKPANGLQQ HPPPPHHHHH SAMNGGGIWP YYTSGIAIPI YPAAPAYWGC MIPPPGAWSL  300
PWPATVQSQA ISSSSPPTSA TPSVSSFTLG KHPREGGDHE ARDHHGNGKV WVPKTIRIDN  360
ADEVARSSIR SLFAFRGGDK ADDNNDDDGT GVHKLATTVF EPKRDSKTAK HPAITSLPLL  420
HTNPVALTRS ATFQEGS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.57360.0callus| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329786050.0
Expression AtlasQ948I5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g26620.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g26620
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0218930.0AC021893.18 Genomic Sequence for Oryza sativa, Nipponbare strain, clone OSJNBa0060A14, from chromosome 10, complete sequence.
GenBankAP0149660.0AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615013.10.0PREDICTED: cyclic dof factor 1
TrEMBLQ948I50.0Q948I5_ORYSJ; Putative H-protein promoter binding factor-2a
STRINGLOC_Os10g26620.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
MonocotsOGMP20993793
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62430.15e-39cycling DOF factor 1