PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g26500.1
Common NameLOC4348578, Os10g0404900, OSNPB_100404900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 356aa    MW: 36848.1 Da    PI: 6.5094
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g26500.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.82.1e-19108161356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k+++++ eq+++Le+ Fe+ +++  e++++LA+ lgL+ rqV +WFqNrRa++k
  LOC_Os10g26500.1 108 KKRRLSVEQVRTLERSFESGNKLEPERKAQLARALGLQPRQVAIWFQNRRARWK 161
                       456899***********************************************9 PP

2HD-ZIP_I/II127.84.7e-41107198192
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                       ekkrrls eqv++LE+sFe+ +kLeperK++lar+Lglqprqva+WFqnrRAR+ktkqlEkd++aL+r++da ++en++L + +++L++e+ 
  LOC_Os10g26500.1 107 EKKRRLSVEQVRTLERSFESGNKLEPERKAQLARALGLQPRQVAIWFQNRRARWKTKQLEKDFDALRRQLDAARAENDALLSLNSKLHAEIV 198
                       69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-1986164IPR009057Homeodomain-like
SuperFamilySSF466891.15E-1997165IPR009057Homeodomain-like
PROSITE profilePS5007117.313103163IPR001356Homeobox domain
SMARTSM003891.8E-19106167IPR001356Homeobox domain
CDDcd000864.14E-17108164No hitNo description
PfamPF000462.2E-16108161IPR001356Homeobox domain
PRINTSPR000315.2E-6134143IPR000047Helix-turn-helix motif
PROSITE patternPS000270138161IPR017970Homeobox, conserved site
PRINTSPR000315.2E-6143159IPR000047Helix-turn-helix motif
PfamPF021831.7E-9163202IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009038anatomypalea
PO:0001048developmental stagepalea development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MRPAMASNGA AAGAMAPFFP PNFLLQMQQP LPLHHQHLQD HAHGGHGGHH LLPPPPPSLS  60
PFLPDLAMDA PPPPMYEASG GDGGGGGAAS EDEEDGCGGG GGGGGGEKKR RLSVEQVRTL  120
ERSFESGNKL EPERKAQLAR ALGLQPRQVA IWFQNRRARW KTKQLEKDFD ALRRQLDAAR  180
AENDALLSLN SKLHAEIVAL KGGAAAAGGG GSSCRQEAAS ELINLNVKET EASCSNRSEN  240
SSEINLDISR PAPPPPPPPA NESPVNRGIP FYASIGRGGA GGVDIDQLLL RGGHSPSPAA  300
VTTPPPPKME LGITGNGGGA DAAAAGAGSF GGLLCGAVDE QPPFWPWADG HHHFH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1155163RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.705140.0leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166313940.0
Expression AtlasA0A0P0XTW0-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g26500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g26500
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2877000.0AK287700.1 Oryza sativa Japonica Group cDNA, clone: J065130H05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613423.10.0PREDICTED: homeobox-leucine zipper protein HOX23
SwissprotA2Z7340.0HOX23_ORYSI; Homeobox-leucine zipper protein HOX23
SwissprotQ94GL50.0HOX23_ORYSJ; Homeobox-leucine zipper protein HOX23
TrEMBLA0A0E0QYV40.0A0A0E0QYV4_ORYRU; Uncharacterized protein
TrEMBLA0A0P0XTW00.0A0A0P0XTW0_ORYSJ; Os10g0404900 protein
STRINGLOC_Os10g26500.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
MonocotsOGMP22893894
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-45HD-ZIP family protein