PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g26460.1
Common NameBHLH173, ILI7, LOC107277392, Os10g0404300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bHLH
Protein Properties Length: 92aa    MW: 10033.4 Da    PI: 9.4376
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g26460.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH18.92.7e-0620581654
                      HHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
               HLH 16 iNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                      i +  ++L+ llP+a   ++ ++  a +L++++ YI+sL
  LOC_Os10g26460.1 20 IGDLVSKLQALLPEARLRSNDRVPSARVLQETCSYIRSL 58
                      5667799*******8899*******************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.280.101.8E-7374IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088810.194458IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474591.02E-8680IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0040008Biological Processregulation of growth
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
MSRRSRSRAS SAARITDEQI GDLVSKLQAL LPEARLRSND RVPSARVLQE TCSYIRSLHR  60
EVDDLSERLA ELLAAADVST AQAAVIRGLL M*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.1011491e-153flower
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ338G6
Functional Description ? help Back to Top
Source Description
UniProtAtypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g26460.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g26460
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8365891e-150CT836589.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA333Z79, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015614007.18e-57PREDICTED: transcription factor ILI7
SwissprotQ338G61e-58ILI7_ORYSJ; Transcription factor ILI7
TrEMBLA0A0E0QYU99e-57A0A0E0QYU9_ORYRU; Uncharacterized protein
STRINGLOC_Os10g26460.12e-56(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18771240
MonocotsOGMP26753378
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.15e-18bHLH family protein
Publications ? help Back to Top
  1. Carretero-Paulet L, et al.
    Genome-wide classification and evolutionary analysis of the bHLH family of transcription factors in Arabidopsis, poplar, rice, moss, and algae.
    Plant Physiol., 2010. 153(3): p. 1398-412
    [PMID:20472752]