PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g25850.1
Common NameLOC4348557, NF-Y21, Os10g0397900, OsHAP2I, OSNPB_100397900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NF-YA
Protein Properties Length: 167aa    MW: 18313.8 Da    PI: 10.2119
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g25850.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA76.94e-2467123158
         CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                       dep+YVNaKQy++I++RRq+R+ + +e+k+ ++ rk++l e+R+k+A+ R+Rg+gGrF
  LOC_Os10g25850.1  67 DEPIYVNAKQYHAIIRRRQRRKIVGSEDKV-AAIRKRILVEARQKQAKLRHRGKGGRF 123
                       79****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.0E-1765126IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115221.8866126IPR001289Nuclear transcription factor Y subunit A
PfamPF020456.8E-1768123IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.2E-136991IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.2E-13100123IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020048anatomymicrospore
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MGFGESTQGN QRKLDGPGKV STELSLVNLE AKNLHPKPEC NQPIEHIPTK GMKCTPLLPL  60
PTEHADDEPI YVNAKQYHAI IRRRQRRKIV GSEDKVAAIR KRILVEARQK QAKLRHRGKG  120
GRFISIEHPL ELSMDDQISK NGGSASPSSS TVSENSSNVN GFTGDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-1367125260NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.227890.0leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ338K5
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g25850.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g25850
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ7314780.0HQ731478.1 Oryza sativa Japonica Group NF-Y transcription factor 21 (NF-Y21) mRNA, complete cds.
GenBankEU8470050.0EU847005.1 Oryza sativa Japonica Group clone KCS241E10 CCAAT-binding transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613426.11e-121PREDICTED: nuclear transcription factor Y subunit A-3
TrEMBLA0A0E0QYQ81e-121A0A0E0QYQ8_ORYRU; Uncharacterized protein
TrEMBLQ338K51e-121Q338K5_ORYSJ; CCAAT-binding transcription factor
STRINGLOC_Os10g25850.11e-120(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP174681010
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.17e-18nuclear factor Y, subunit A3
Publications ? help Back to Top
  1. Thirumurugan T,Ito Y,Kubo T,Serizawa A,Kurata N
    Identification, characterization and interaction of HAP family genes in rice.
    Mol. Genet. Genomics, 2008. 279(3): p. 279-89
    [PMID:18193457]