PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g23090.2
Common NameHOX8, LOC4348492, Os10g0377300, OSJNBa0095C06.14
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 282aa    MW: 30045.8 Da    PI: 4.8227
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g23090.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.26.6e-194194356
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      k++++ +eq+++Le+ Fe +++++ e+++++A+ l+L  rqV vWFqNrRa++k
  LOC_Os10g23090.2 41 KKRRLAAEQVRALERSFEADNKLDPERKARIARDLRLHPRQVAVWFQNRRARWK 94
                      4557899**********************************************9 PP

2HD-ZIP_I/II1261.7e-4040132193
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       ekkrrl++eqv++LE+sFe+++kL+perK+++ar+L+l+prqvavWFqnrRAR+ktkq+E+d++aL++++dal+ e ++L++++++L++e+++
  LOC_Os10g23090.2  40 EKKRRLAAEQVRALERSFEADNKLDPERKARIARDLRLHPRQVAVWFQNRRARWKTKQIERDFAALRSRHDALRLECDALRRDKDALAAEIAD 132
                       69**************************************************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-192097IPR009057Homeodomain-like
SuperFamilySSF466891.8E-183298IPR009057Homeodomain-like
PROSITE profilePS5007116.5523696IPR001356Homeobox domain
SMARTSM003891.6E-1839100IPR001356Homeobox domain
PfamPF000463.3E-164194IPR001356Homeobox domain
CDDcd000869.14E-174197No hitNo description
PROSITE patternPS0002707194IPR017970Homeobox, conserved site
PfamPF021833.8E-1396136IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MRSYMDGGGA AAYEEEEEEV EDDDGGGGGG GGGGGGGLGE KKRRLAAEQV RALERSFEAD  60
NKLDPERKAR IARDLRLHPR QVAVWFQNRR ARWKTKQIER DFAALRSRHD ALRLECDALR  120
RDKDALAAEI ADLRDRVDGQ MSVKLEAVAA DEHQPPPPPP PPPLAYNSKV VDGSTDSDSS  180
AVFNEEASPY SGAAIDHHHH QTPASYDTAG FTSFFAPSTT LTSSLSFPSM FHASSHFDGH  240
QELLVGGGGA GAVADADLGG AGFFAGDEHA GGLSWYGAEG W*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18896RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.85980.0callus| flower| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166313190.0
Expression AtlasQ338Z7-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g23090.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g23090
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0799350.0AC079935.3 Genomic sequence for Oryza sativa (japonica cultivar-group) cultivar Nipponbare clone OSJNBa0095C06, from Chromosome 10, complete sequence.
GenBankAY3463290.0AY346329.1 Oryza sativa (indica cultivar-group) homeodomain leucine-zipper protein Hox8 mRNA, complete cds.
GenBankAP0149660.0AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
GenBankAK2432940.0AK243294.1 Oryza sativa Japonica Group cDNA, clone: J100053F20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613231.10.0PREDICTED: homeobox-leucine zipper protein HOX8
SwissprotQ338Z70.0HOX8_ORYSJ; Homeobox-leucine zipper protein HOX8
TrEMBLA0A0E0IRI31e-155A0A0E0IRI3_ORYNI; Uncharacterized protein
STRINGLOC_Os10g23090.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.11e-33homeobox protein 16
Publications ? help Back to Top
  1. Agalou A, et al.
    A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members.
    Plant Mol. Biol., 2008. 66(1-2): p. 87-103
    [PMID:17999151]