PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g23090.1
Common NameHOX8, LOC4348492, Os10g0377300, OSJNBa0095C06.14
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 306aa    MW: 32734.7 Da    PI: 4.8565
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g23090.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox597.6e-1965118356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k++++ +eq+++Le+ Fe +++++ e+++++A+ l+L  rqV vWFqNrRa++k
  LOC_Os10g23090.1  65 KKRRLAAEQVRALERSFEADNKLDPERKARIARDLRLHPRQVAVWFQNRRARWK 118
                       4557899**********************************************9 PP

2HD-ZIP_I/II125.82e-4064156193
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       ekkrrl++eqv++LE+sFe+++kL+perK+++ar+L+l+prqvavWFqnrRAR+ktkq+E+d++aL++++dal+ e ++L++++++L++e+++
  LOC_Os10g23090.1  64 EKKRRLAAEQVRALERSFEADNKLDPERKARIARDLRLHPRQVAVWFQNRRARWKTKQIERDFAALRSRHDALRLECDALRRDKDALAAEIAD 156
                       69**************************************************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.9E-1944121IPR009057Homeodomain-like
SuperFamilySSF466892.14E-1857122IPR009057Homeodomain-like
PROSITE profilePS5007116.55260120IPR001356Homeobox domain
SMARTSM003891.6E-1863124IPR001356Homeobox domain
CDDcd000861.27E-1665121No hitNo description
PfamPF000463.7E-1665118IPR001356Homeobox domain
PROSITE patternPS00027095118IPR017970Homeobox, conserved site
PfamPF021834.2E-13120160IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MKRPSCRGSS MAIIHDTSDQ QEDNMRSYMD GGGAAAYEEE EEEVEDDDGG GGGGGGGGGG  60
GLGEKKRRLA AEQVRALERS FEADNKLDPE RKARIARDLR LHPRQVAVWF QNRRARWKTK  120
QIERDFAALR SRHDALRLEC DALRRDKDAL AAEIADLRDR VDGQMSVKLE AVAADEHQPP  180
PPPPPPPLAY NSKVVDGSTD SDSSAVFNEE ASPYSGAAID HHHHQTPASY DTAGFTSFFA  240
PSTTLTSSLS FPSMFHASSH FDGHQELLVG GGGAGAVADA DLGGAGFFAG DEHAGGLSWY  300
GAEGW*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1112120RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.85980.0callus| flower| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166313190.0
Expression AtlasQ338Z7-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g23090.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g23090
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2432940.0AK243294.1 Oryza sativa Japonica Group cDNA, clone: J100053F20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613231.10.0PREDICTED: homeobox-leucine zipper protein HOX8
SwissprotQ338Z70.0HOX8_ORYSJ; Homeobox-leucine zipper protein HOX8
TrEMBLA0A0E0IRI31e-174A0A0E0IRI3_ORYNI; Uncharacterized protein
STRINGLOC_Os10g23090.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.11e-33homeobox protein 16
Publications ? help Back to Top
  1. Agalou A, et al.
    A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members.
    Plant Mol. Biol., 2008. 66(1-2): p. 87-103
    [PMID:17999151]