PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g22430.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 542aa    MW: 59930.6 Da    PI: 6.1705
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g22430.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS433.81.3e-1321715401373
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l++++++c +av+++d +l++ l+++l +++s +gdp+qRl ay++e+L arl++s+s++yk+l+++e +   sse +++++l++e++P++kf
  LOC_Os10g22430.1 171 LKQVIIACGKAVAENDVRLTELLISELGQMVSVSGDPLQRLGAYMLEGLVARLSSSGSKIYKSLKCKEPT---SSELMSYMHLLYEICPFFKF 260
                       57899****************************************************************9...9******************* PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvak 184
                       +++ aN aI ea++ge+ vHiiDf+i qG QW++L+qaLa+Rp+gpp lRiTg+++++s   +   l  +g rL k+A+++g+pfefn+ v  
  LOC_Os10g22430.1 261 GYMSANGAIAEAIKGENFVHIIDFQIAQGSQWMTLIQALAARPGGPPFLRITGIDDSNSAyaRGGGLDIVGMRLYKVAQSFGLPFEFNA-VPA 352
                       ********************************************************988899999************************.799 PP

              GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                       + +++ le+L+++ gE+++Vn+++qlh+++desvs+e++rd++L++vkslsP++v++veqe+++n+ +F+ r le+l+yy+a+f+s+++ lpr
  LOC_Os10g22430.1 353 ASHEVYLEHLDIRVGEVIVVNFAYQLHHTPDESVSTENHRDRILRMVKSLSPRLVTLVEQESNTNTRPFFPRYLETLDYYTAMFESIDVALPR 445
                       99******************************************************************************************* PP

              GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsv 370
                       +++ r++ E+++++r+ivn++acegaer+erhe ++kW++rl++aGF+p+pls+ +++++k+ll++++s  yr+ee++g l+lgWk+r Lv+ 
  LOC_Os10g22430.1 446 DDKRRMSAEQHCVARDIVNLIACEGAERVERHEVFGKWKARLTMAGFRPYPLSSVVNSTIKTLLHTYNSF-YRLEERDGVLYLGWKNRVLVVS 537
                       ********************************************************************65.********************** PP

              GRAS 371 SaW 373
                       SaW
  LOC_Os10g22430.1 538 SAW 540
                       *** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.493145522IPR005202Transcription factor GRAS
PfamPF035144.5E-130171540IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0005737Cellular Componentcytoplasm
GO:0004871Molecular Functionsignal transducer activity
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
MSARASNHAY ICSDDSQMPY YNNSVPSGGN GRFYITQNHQ DAHYASSDDG SQKIGSSPQA  60
FEAPYCTLES SSANGAHPAH SSASSHSISP ISGSPLSHHD SHSDHTYNSP PSASCVTEIT  120
DLQIKLRELE NAILGPELDI AYDSPESALQ PNIMATPENW RQLLGINTGD LKQVIIACGK  180
AVAENDVRLT ELLISELGQM VSVSGDPLQR LGAYMLEGLV ARLSSSGSKI YKSLKCKEPT  240
SSELMSYMHL LYEICPFFKF GYMSANGAIA EAIKGENFVH IIDFQIAQGS QWMTLIQALA  300
ARPGGPPFLR ITGIDDSNSA YARGGGLDIV GMRLYKVAQS FGLPFEFNAV PAASHEVYLE  360
HLDIRVGEVI VVNFAYQLHH TPDESVSTEN HRDRILRMVK SLSPRLVTLV EQESNTNTRP  420
FFPRYLETLD YYTAMFESID VALPRDDKRR MSAEQHCVAR DIVNLIACEG AERVERHEVF  480
GKWKARLTMA GFRPYPLSSV VNSTIKTLLH TYNSFYRLEE RDGVLYLGWK NRVLVVSSAW  540
C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-571735406374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.224720.0callus| leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329683700.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g22430.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g22430
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1133350.0AC113335.1 Genomic sequence for Oryza sativa (japonica cultivar-group) cultivar Nipponbare clone OJ1003C07, from chromosome 10, complete sequence.
GenBankAP0149660.0AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015614551.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_015614552.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ8GVE10.0CIGR2_ORYSJ; Chitin-inducible gibberellin-responsive protein 2
TrEMBLA0A0D3HCW90.0A0A0D3HCW9_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0B9L30.0A0A0E0B9L3_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0QY930.0A0A0E0QY93_ORYRU; Uncharacterized protein
STRINGLOC_Os10g22430.10.0(Oryza sativa Japonica Group)
STRINGORGLA10G0063900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14091447
MonocotsOGMP151337117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein