PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g21560.2
Common NameLOC4348439, OsJ_31218
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 334aa    MW: 36785 Da    PI: 4.7228
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g21560.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM371e-1176865128
               NAM  65 dkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                        ++ ++g+++  + k+gyWk  g+ +  +  ++  vg+k +L  y+g+ap+g++t Wvm+ey +
  LOC_Os10g21560.2   7 PQSPKNGENAIIKSKTGYWKVVGTVRIPT--STVIVGMKVSLDHYEGEAPSGKRTGWVMDEYLI 68 
                       4555566777778899*******966554..5899***************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100520.461189IPR003441NAC domain
SuperFamilySSF1019411.12E-17389IPR003441NAC domain
PfamPF023652.4E-41966IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MNFSDDPQSP KNGENAIIKS KTGYWKVVGT VRIPTSTVIV GMKVSLDHYE GEAPSGKRTG  60
WVMDEYLIEQ NDEANLPQDY KNLCTIFFQG DDILNAGDKQ ICLNANVPNE RKEFYLQYLA  120
ELEEQNAAWS NQAVSVNEQD VSSSKGLDGQ KTSAADDQSV NHAPSREGYI ELNDFLNSDS  180
SASTSEYSSQ RTMISEEYFD SDAFLREIRN DHNAADEEHT DSKFSVAAAS KSDCVVISPP  240
EQGFVNNLDN HATIAGDSPQ KSVKNDKVDE HSSEEHPQHS PTTSCFPSHV KRSLSSSSSS  300
SQGTSNSKSP QRQRERSTKK IGKLGKYWCC GSL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.61240.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329827050.0
Expression AtlasB9G5C2-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g21560.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g21560
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0726820.0AK072682.1 Oryza sativa Japonica Group cDNA clone:J023135B15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015614544.10.0PREDICTED: protein ATAF2 isoform X1
RefseqXP_015614548.10.0PREDICTED: NAC domain-containing protein 86 isoform X3
TrEMBLB9G5C20.0B9G5C2_ORYSJ; Uncharacterized protein
TrEMBLQ339G00.0Q339G0_ORYSJ; No apical meristem protein, expressed
STRINGLOC_Os10g21560.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.14e-12NAC domain containing protein 2