PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g20990.1
Common NameOSJNAb0078C13.24
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 562aa    MW: 62906.1 Da    PI: 10.8483
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g20990.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.33.1e-07226269348
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       ++T+ +d+ l++++ +lG + Wk I r +  gRt    k+rw+ ++
  LOC_Os10g20990.1 226 PFTARDDDELLRLHYRLGDR-WKEIGRAVY-GRTSRVMKHRWRELR 269
                       79****************99.********9.***********9875 PP

2Myb_DNA-binding23.99.6e-083704021447
                       HHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  14 davkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++vk+ G ++W+++ar m+ +R++  c++rw  +
  LOC_Os10g20990.1 370 RLVKENGFRHWSRVARIMP-RRSARLCRDRWCHH 402
                       69*****************.***********877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF001645.4E-3680176IPR006032Ribosomal protein S12/S23
SuperFamilySSF502492.48E-2091176IPR012340Nucleic acid-binding, OB-fold
Gene3DG3DSA:2.40.50.1407.6E-2091175IPR012340Nucleic acid-binding, OB-fold
PROSITE profilePS512948.003219273IPR017930Myb domain
SuperFamilySSF466896.28E-8222271IPR009057Homeodomain-like
SMARTSM007178.4E-4223271IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.1E-8225268IPR009057Homeodomain-like
CDDcd001678.93E-4226268No hitNo description
PROSITE profilePS5129411.654359407IPR017930Myb domain
SMARTSM007172363405IPR001005SANT/Myb domain
CDDcd001672.37E-5367403No hitNo description
SuperFamilySSF466891.92E-15367434IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.0E-11368410IPR009057Homeodomain-like
PfamPF139211.9E-6370414No hitNo description
PROSITE profilePS500906.446404454IPR017877Myb-like domain
SMARTSM007170.018408456IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.8E-8411453IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006412Biological Processtranslation
GO:0022627Cellular Componentcytosolic small ribosomal subunit
GO:0003677Molecular FunctionDNA binding
GO:0003735Molecular Functionstructural constituent of ribosome
Sequence ? help Back to Top
Protein Sequence    Length: 562 aa     Download sequence    Send to blast
MRVGKAKRRL DLSTRRGTDE GGRTNCWKTA TSAPSLARAT AVRVLATDPD PSGVACVRCD  60
VNGERVRAWS CGAKTCGMGA GRKLKTHRRN QRWADKAYKK SHFGNEWKKP FAGSSHAKGI  120
VLEKIGIEAK QPNSAICKCA RVQLVKNGKK IAAFVPNDGC LNFIKENEVA YVDGIYGIKV  180
LVDALSSSRL RGRDGSGGDH GDATAAAAAS REVAPPPRPR DVYHRPFTAR DDDELLRLHY  240
RLGDRWKEIG RAVYGRTSRV MKHRWRELRR GGFLAAAARK ELAALDMADD MVETSEVEEP  300
ADQSLPSLEL QRSTLADTLA SSFGSCSLAT DHVMDPLAGS LALGKYQFFT IIKIEDVFTG  360
TLVRHPWLPR LVKENGFRHW SRVARIMPRR SARLCRDRWC HHLARDVYHR PFTARDDDEL  420
LRLHYRLGDC WKKIGHAVYG RTSRVMNHRW RELRRSGFLA AAARTEQKLD MADDMVESEV  480
EESDQSLPTT RKSIIATGRK GSLQAGQPSA CKPTTVKIAD LRRRGGRPPA KIIFAGGRWL  540
VRSACEKKNR PPTKKNFRLR R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4v3p_SL6e-5773175210440S ribosomal protein S23
4v7e_BX6e-5773175210440S ribosomal protein S12
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2976103250.0
Expression AtlasQ8LM39-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g20990.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g20990
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1235940.0AC123594.1 Oryza sativa (japonica cultivar-group) chromosome 10 clone OSJNAb0078C13, complete sequence.
GenBankAC0927490.0AC092749.1 Genomic sequence for Oryza sativa (japonica cultivar-group) cultivar Nipponbare clone OSJNBb0023M11, from chromosome 10, complete sequence.
GenBankAP0149660.0AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLQ8LM390.0Q8LM39_ORYSJ; Putative ribosomal protein S23 (S12)
STRINGLOC_Os10g20990.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3110644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.14e-18myb domain protein 73