PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g02620.1
Common NameLOC4347984, Os10g0115500, OSNPB_100115500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family BBR-BPC
Protein Properties Length: 344aa    MW: 37750 Da    PI: 10.4877
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g02620.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind306.97.4e-94543431301
         GAGA_bind   1 mdddgsre....rnkg.yyepaaslkenlglqlmssia.erdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllv 87 
                       m+dd+s++    r +g +yep    ++nlglqlmss++ +rd+k       ls++   ++++  ++       +++++ +++rd    a+   
  LOC_Os10g02620.1  54 MNDDASMSsmglRGWGaFYEPP---ARNLGLQLMSSVPaDRDTKHL-----LSATPFLHHHQHQQY-----VPHHHHQPHHPRDCGTNANAN- 132
                       7777777667789***9***99...88**********989998754.....455555666666777.....333345577788876655544. PP

         GAGA_bind  88 enslasalpvgvqvlsgtksidslqqlse..pqledsave.lreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkk 177
                            + ++vg+++++ t+++ +lq++ e  pql++++ +  ++ee+++ + +ee++    + + +kkrq++++pk+ + kk+kk ++++ ++
  LOC_Os10g02620.1 133 ----GNGNGVGYGMMPATHTLRMLQHQPEpqPQLQHPPSPpHPKEECISPPLMEENV--PVKPPPPKKRQQGRQPKVLRPKKPKK-PAAPCED 218
                       ....345799************99997666799*99999978999999888877755..5678899999****************.88999** PP

         GAGA_bind 178 vkkesad.erskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklL 269
                        +++sa+ +r++ ++k+i++v+ng++lD s++P+ +CsCtGa++q Y+WG+GGWqSaCCttt+S+yPLP+s k rgaRiagrKmS+gafkk+L
  LOC_Os10g02620.1 219 GAPPSAPaPRRRGPRKNIGMVINGIDLDLSRIPTRICSCTGAPQQRYRWGAGGWQSACCTTTVSTYPLPMSMKPRGARIAGRKMSHGAFKKVL 311
                       *****999************************************************************************************* PP

         GAGA_bind 270 ekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                       ekLa+eGy+l+np+DLk++WAkHGtnkfvtir
  LOC_Os10g02620.1 312 EKLASEGYNLNNPIDLKTFWAKHGTNKFVTIR 343
                       *******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062171.5E-10654343IPR010409GAGA-binding transcriptional activator
SMARTSM012267.2E-17154343IPR010409GAGA-binding transcriptional activator
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MAVVDMHGGS WGGGDGEGGV EVEGEGRKWR WKGRHQHGSA YISGPDRRFG GGEMNDDASM  60
SSMGLRGWGA FYEPPARNLG LQLMSSVPAD RDTKHLLSAT PFLHHHQHQQ YVPHHHHQPH  120
HPRDCGTNAN ANGNGNGVGY GMMPATHTLR MLQHQPEPQP QLQHPPSPPH PKEECISPPL  180
MEENVPVKPP PPKKRQQGRQ PKVLRPKKPK KPAAPCEDGA PPSAPAPRRR GPRKNIGMVI  240
NGIDLDLSRI PTRICSCTGA PQQRYRWGAG GWQSACCTTT VSTYPLPMSM KPRGARIAGR  300
KMSHGAFKKV LEKLASEGYN LNNPIDLKTF WAKHGTNKFV TIR*
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO457589040.0
Expression AtlasA0A0P0XRW0-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g02620.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g02620
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5705210.0AY570521.1 Oryza sativa (japonica cultivar-group) barley B recombinant like protein C mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015614002.10.0PREDICTED: barley B recombinant-like protein C
SwissprotQ7XH850.0BBRC_ORYSJ; Barley B recombinant-like protein C
TrEMBLA0A0P0XRW00.0A0A0P0XRW0_ORYSJ; Os10g0115500 protein
STRINGLOC_Os10g02620.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18651240
MonocotsOGMP22113697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.32e-55basic pentacysteine 2
Publications ? help Back to Top
  1. Santi L, et al.
    The GA octodinucleotide repeat binding factor BBR participates in the transcriptional regulation of the homeobox gene Bkn3.
    Plant J., 2003. 34(6): p. 813-26
    [PMID:12795701]