PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g02584.3
Common NameLOC4347983, LOC9268674, OJ1014H12.2, Os10g0114500, OsJ_30525, OSJNBa0092N12.11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family BBR-BPC
Protein Properties Length: 342aa    MW: 37750 Da    PI: 10.2984
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g02584.3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind410.52.1e-12513411301
         GAGA_bind   1 mdddgsre.rnkg.yyepaaslkenlglqlmssia.erdaki...........rernlalsekkaavaerd...................... 57 
                       mddd+s++ r +g ++e+    ++nlglqlmss++ erd+k+           +++++  +++++++++rd                      
  LOC_Os10g02584.3   1 MDDDASMSiR-WGgFFESP---ARNLGLQLMSSVPaERDTKQllsgspflhhqHQQHV-PHHHHQPHHPRDcgangnanggamppppateapp 88 
                       9*******66.777***99...88**********99**************99656666.9********************************* PP

         GAGA_bind  58 ...maflqrdkalae..rnkalverdnkllalllvensla...salpvgvqvlsgtksidslqqlsepqledsave.lreeeklealpieeaa 141
                          m+f+++d++++   +++++++r++k+l++l+v ++++   +++pvg+++++gt++++++qq++epql++++ + +++ee+++++ iee++
  LOC_Os10g02584.3  89 smpMNFARSDMWMHPqqQQQHHHPREHKALHNLTVGHGSShiaHHDPVGYGMIPGTHTLQMMQQQTEPQLQPPPPPqQPKEECISSPLIEENV 181
                       *************9754778999**************9988999****************************9999899************** PP

         GAGA_bind 142 eeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesad.erskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSa 233
                       ++++e + +kkrq++++pk+++akk+kk s++++++ ++++a+ +r++ ++k+i++v+ng++lD s++P+P+CsCtGa++qCY+WG+GGWqSa
  LOC_Os10g02584.3 182 PVIDEPPPPKKRQQGRQPKVPRAKKPKK-SAAPREDGAPPNAPaPRRRGPRKNIGMVINGIDLDLSRIPTPICSCTGAPQQCYRWGAGGWQSA 273
                       ****************************.88999*******999************************************************* PP

         GAGA_bind 234 CCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                       CCtttiS+yPLP+stkrrgaRiagrKmS+gafkk+LekLa+eGy+l+np+DLk++WAkHGtnkfvtir
  LOC_Os10g02584.3 274 CCTTTISTYPLPMSTKRRGARIAGRKMSHGAFKKVLEKLAGEGYNLNNPIDLKTFWAKHGTNKFVTIR 341
                       *******************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012262.9E-1981341IPR010409GAGA-binding transcriptional activator
PfamPF062173.2E-1181341IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MDDDASMSIR WGGFFESPAR NLGLQLMSSV PAERDTKQLL SGSPFLHHQH QQHVPHHHHQ  60
PHHPRDCGAN GNANGGAMPP PPATEAPPSM PMNFARSDMW MHPQQQQQHH HPREHKALHN  120
LTVGHGSSHI AHHDPVGYGM IPGTHTLQMM QQQTEPQLQP PPPPQQPKEE CISSPLIEEN  180
VPVIDEPPPP KKRQQGRQPK VPRAKKPKKS AAPREDGAPP NAPAPRRRGP RKNIGMVING  240
IDLDLSRIPT PICSCTGAPQ QCYRWGAGGW QSACCTTTIS TYPLPMSTKR RGARIAGRKM  300
SHGAFKKVLE KLAGEGYNLN NPIDLKTFWA KHGTNKFVTI R*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.204960.0callus| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329736610.0
GEO457382050.0
Expression AtlasP0DH88-
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00253DAPTransfer from AT2G01930Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g02584.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g02584
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1451270.0AC145127.1 Oryza sativa Japonica Group chromosome 10 clone Pseudo10p0.0-10p4.4, complete sequence.
GenBankAC0986940.0AC098694.3 Oryza sativa Japonica Group chromosome 10 clone OJ1014H12, complete sequence.
GenBankAC0788910.0AC078891.2 Oryza sativa Japonica Group chromosome 10 clone OSJNBa0092N12, complete sequence.
GenBankAY5690370.0AY569037.1 Oryza sativa (japonica cultivar-group) barley B recombinant like-protein B mRNA, complete cds.
GenBankAY5690360.0AY569036.1 Oryza sativa (japonica cultivar-group) barley B recombinant like-protein B gene, complete cds.
GenBankAY5690350.0AY569035.1 Oryza sativa (japonica cultivar-group) barley B recombinant like-protein A mRNA, complete cds.
GenBankAP0149660.0AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
GenBankAK0636430.0AK063643.1 Oryza sativa Japonica Group cDNA clone:001-118-H02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612731.10.0PREDICTED: barley B recombinant-like protein A
RefseqXP_015612730.10.0PREDICTED: barley B recombinant-like protein A
RefseqXP_015612727.10.0PREDICTED: barley B recombinant-like protein A
RefseqXP_015612725.10.0PREDICTED: barley B recombinant-like protein A
SwissprotP0DH880.0BBRA_ORYSJ; Barley B recombinant-like protein A
SwissprotP0DH890.0BBRB_ORYSJ; Barley B recombinant-like protein B
TrEMBLA0A0E0QVN80.0A0A0E0QVN8_ORYRU; Uncharacterized protein
STRINGLOC_Os10g02584.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.32e-60basic pentacysteine 2
Publications ? help Back to Top
  1. Santi L, et al.
    The GA octodinucleotide repeat binding factor BBR participates in the transcriptional regulation of the homeobox gene Bkn3.
    Plant J., 2003. 34(6): p. 813-26
    [PMID:12795701]