PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g38010.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 219aa    MW: 25268.4 Da    PI: 7.3004
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g38010.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.91.2e-5461331128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                       lppGfrFhPtdeelv++yLk+kv+g +++l ++i+evd+yk+ePw+L+ k  + ++++ewyfF +rd+ky++g r+nrat++gyWk+tgkd++
  LOC_Os09g38010.2   6 LPPGFRFHPTDEELVNYYLKRKVHGLSIDL-DIIPEVDLYKCEPWELEeKsFLPSKDSEWYFFGPRDRKYPNGCRTNRATRAGYWKSTGKDRR 97 
                       79****************************.99**************84345566899*********************************** PP

               NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +   +++ +g+kktLv+ykgrap+g +t+Wvmheyr+
  LOC_Os09g38010.2  98 INY-QNRSIGMKKTLVYYKGRAPQGIRTSWVMHEYRI 133
                       **9.8899***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.06E-614159IPR003441NAC domain
PROSITE profilePS5100559.1716158IPR003441NAC domain
PfamPF023658.8E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MAPVGLPPGF RFHPTDEELV NYYLKRKVHG LSIDLDIIPE VDLYKCEPWE LEEKSFLPSK  60
DSEWYFFGPR DRKYPNGCRT NRATRAGYWK STGKDRRINY QNRSIGMKKT LVYYKGRAPQ  120
GIRTSWVMHE YRIEESECEN AMGIQLQDSY ALCRIFKKNV VLGEFDKKGE CSSSQAKGNE  180
EVTDFGDAGQ SSGANENDKD NSWMQFIAED LWCTNKLK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-54115915169NAC domain-containing protein 19
3swm_B2e-54115915169NAC domain-containing protein 19
3swm_C2e-54115915169NAC domain-containing protein 19
3swm_D2e-54115915169NAC domain-containing protein 19
3swp_A2e-54115915169NAC domain-containing protein 19
3swp_B2e-54115915169NAC domain-containing protein 19
3swp_C2e-54115915169NAC domain-containing protein 19
3swp_D2e-54115915169NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.135700.0seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1127864080.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g38010.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g38010
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126171e-155CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
GenBankAC1375961e-155AC137596.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 9 clone OSJNBb0031H05, complete sequence.
GenBankAP0149651e-155AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankAP0055641e-155AP005564.2 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OJ1228_C03, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612703.11e-165PREDICTED: NAC domain-containing protein 86 isoform X1
SwissprotQ9FFI51e-88NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A0E0B6921e-163A0A0E0B692_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0EUN41e-163A0A0E0EUN4_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0INE01e-163A0A0E0INE0_ORYNI; Uncharacterized protein
TrEMBLA2Z3V61e-163A2Z3V6_ORYSI; Putative uncharacterized protein
TrEMBLI1QR391e-163I1QR39_ORYGL; Uncharacterized protein
STRINGLOC_Os09g38010.21e-164(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP37133879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-107NAC domain containing protein 57