PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g38010.1
Common NameLOC4347798, Os09g0552900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 217aa    MW: 25027.2 Da    PI: 7.3004
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g38010.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.91.1e-5461331128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                       lppGfrFhPtdeelv++yLk+kv+g +++l ++i+evd+yk+ePw+L+ k  + ++++ewyfF +rd+ky++g r+nrat++gyWk+tgkd++
  LOC_Os09g38010.1   6 LPPGFRFHPTDEELVNYYLKRKVHGLSIDL-DIIPEVDLYKCEPWELEeKsFLPSKDSEWYFFGPRDRKYPNGCRTNRATRAGYWKSTGKDRR 97 
                       79****************************.99**************84345566899*********************************** PP

               NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +   +++ +g+kktLv+ykgrap+g +t+Wvmheyr+
  LOC_Os09g38010.1  98 INY-QNRSIGMKKTLVYYKGRAPQGIRTSWVMHEYRI 133
                       **9.8899***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-634157IPR003441NAC domain
PROSITE profilePS5100559.2976156IPR003441NAC domain
PfamPF023658.6E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MAPVGLPPGF RFHPTDEELV NYYLKRKVHG LSIDLDIIPE VDLYKCEPWE LEEKSFLPSK  60
DSEWYFFGPR DRKYPNGCRT NRATRAGYWK STGKDRRINY QNRSIGMKKT LVYYKGRAPQ  120
GIRTSWVMHE YRIEESECEN AMGIQDSYAL CRIFKKNVVL GEFDKKGECS SSQAKGNEEV  180
TDFGDAGQSS GANENDKDNS WMQFIAEDLW CTNKLK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-55115712166NO APICAL MERISTEM PROTEIN
1ut4_B1e-55115712166NO APICAL MERISTEM PROTEIN
1ut7_A1e-55115712166NO APICAL MERISTEM PROTEIN
1ut7_B1e-55115712166NO APICAL MERISTEM PROTEIN
4dul_A1e-55115712166NAC domain-containing protein 19
4dul_B1e-55115712166NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.135700.0seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1127864080.0
Expression AtlasQ0IZS4-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g38010.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g38010
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126171e-156CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
GenBankAC1375961e-156AC137596.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 9 clone OSJNBb0031H05, complete sequence.
GenBankAP0149651e-156AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankAP0055641e-156AP005564.2 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OJ1228_C03, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612704.11e-163PREDICTED: NAC domain-containing protein 86 isoform X2
SwissprotQ9FFI52e-90NAC86_ARATH; NAC domain-containing protein 86
TrEMBLQ0IZS41e-163Q0IZS4_ORYSJ; Os09g0552900 protein
STRINGLOC_Os09g38010.21e-161(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-109NAC domain containing protein 57