PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g37710.2
Common NameLOC9268032, Os09g0549450, OSNPB_090549450
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Nin-like
Protein Properties Length: 843aa    MW: 92594 Da    PI: 6.7424
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g37710.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.75.5e-29527577252
            RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       ek++sl++l++yF++++kdAAk+Lgvc+T+LKriCRq+GI+RWP+Rkik++
  LOC_Os09g37710.2 527 EKTVSLQVLRQYFAGSLKDAAKSLGVCPTTLKRICRQHGINRWPSRKIKKV 577
                       799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.734516597IPR003035RWP-RK domain
PfamPF020429.7E-26529577IPR003035RWP-RK domain
SuperFamilySSF542779.48E-21734830No hitNo description
PROSITE profilePS5174518.47744827IPR000270PB1 domain
SMARTSM006661.6E-18744827IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.3E-24744825No hitNo description
CDDcd064078.29E-44745825No hitNo description
PfamPF005641.5E-15745825IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 843 aa     Download sequence    Send to blast
MEEGDPQPSI SLARTPSEGA AAAVDLDLLE QLLSADNAWL EVAANTSRSP NFFATPSNCL  60
TDASVATTTP ANSWWIQPSG ASTSVRERFD QALAYIRETQ SDADVLVQLW VPVKGNDGQL  120
VLTTSGQPFT LDQRSNSLIQ FREVSTKYQF SADVASGSSP GLPGRVFIGR LPEWSPDVRY  180
FTSYEYPRIN HAQYLDVHGT MGLPVFERGN YSCLGVIELI MTKQKLNFTS ELNTICSALQ  240
AVNLTSTEVS SIPRAKLNSA SYKDALPEIL EVLRAACITH KLPLAQTWVT CAQQGKRGSR  300
HSDENYKYCI STIDAACYVN EPRMQSFHEA CSEHHLLRGQ GVAGKAFTTN QPCFLPDIGS  360
STKLEYPLSH HAKIFNLKGA VAIRLRCTRT GIADFVLEFF LPTDCEVLEE QKAVLDSLSG  420
TMRSVCQTLR VVTDKEMEDE AMREMNELNS FSPRGKNKVE ELSFGDNTRG DREEASWTTL  480
VGTSQKGSDL AELHTHGMLS HGGHGSSQAG DQTSKEGSKV KRRTKTEKTV SLQVLRQYFA  540
GSLKDAAKSL GVCPTTLKRI CRQHGINRWP SRKIKKVDHS LRKLQQIIDS VHGAETAFQL  600
NTLYKDLTNT SVSSDNNLSG SVTVPLANQN NLDFEMHQHH RLSSNIPSTS LSHSSCSQSS  660
DSSPSCSGGA TKHSPQVGAD QVRSGCLPQH SPVQTLQTEA ASINEHFSGQ EAPIDLLQDV  720
AEKANGEQHM SQSPSSPKQT ANVGMRVKVT FGSEKVRFRL KPECDFQELK QEISKRLSIA  780
DMNSLIVKYL DDDSEWVLMT CDADLHECFH VYKLADIQTI KISVHLAASP TTRITIGHTG  840
FS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.715630.0callus| flower| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasA0A0P0XQL5
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g37710.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g37710
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126170.0CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankAP0056790.0AP005679.2 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OJ1210_A07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612116.10.0PREDICTED: protein NLP1-like isoform X2
RefseqXP_015612117.10.0PREDICTED: protein NLP1-like isoform X2
TrEMBLA0A0P0XQL50.0A0A0P0XQL5_ORYSJ; Os09g0549450 protein
STRINGLOC_Os09g37710.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.10.0Nin-like family protein