PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g36910.1
Common NameLOC9271661, Os09g0540800, OSNPB_090540800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 196aa    MW: 21094.9 Da    PI: 10.8857
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g36910.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_157.72.5e-18125178457
                       XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                       ++r rr++kNRe+A rsR+RK+a++ +Le++v++L++eNk+L+ + e+l+k+v+
  LOC_Os09g36910.1 125 DRRKRRMIKNRESAARSRARKQARVNNLETEVEQLKQENKMLRVKYEQLRKTVE 178
                       789************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-12122189IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.8E-17124178No hitNo description
PROSITE profilePS5021712.093124178IPR004827Basic-leucine zipper domain
PfamPF001702.5E-16125178IPR004827Basic-leucine zipper domain
CDDcd147075.12E-20126176No hitNo description
SuperFamilySSF579595.44E-13126178No hitNo description
PROSITE patternPS000360129144IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MAMEDDEDMW ANTSSPSASP PRPRGFISTA LSLNSTHLQG LLPSSFVDAA ASPCHASGNN  60
NGGGDGRNAA PMSSIFFASA SYHQQQHHLP APAPLDGAIL PARRFGLDMC AAAAAAPAGV  120
PAAGDRRKRR MIKNRESAAR SRARKQARVN NLETEVEQLK QENKMLRVKY EQLRKTVEVP  180
VPVRRTLQRV LSAPF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.832250.0panicle
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasA0A0P0XR34
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g36910.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g36910
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8359080.0CT835908.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN083I14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611345.11e-142PREDICTED: uncharacterized protein LOC9271661
TrEMBLA0A0E0QUH61e-142A0A0E0QUH6_ORYRU; Uncharacterized protein
TrEMBLA0A0P0XR341e-142A0A0P0XR34_ORYSJ; Os09g0540800 protein
STRINGLOC_Os09g36910.11e-142(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1475044
MonocotsOGMP97643044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17770.24e-09basic region/leucine zipper motif 27