PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g36250.1
Common NameLOC4347679, OJ1112_E07.2, Os09g0532900, OsJ_30116, OSNPB_090532900, P0515E01.21
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 286aa    MW: 31171.9 Da    PI: 6.1653
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g36250.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.96.3e-151461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT+eEd++l   +   G  +W+++++  g+ R++k+c++rw +yl
  LOC_Os09g36250.1 14 RGPWTAEEDKKLMSFILTNGHCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                      89******************************99************97 PP

2Myb_DNA-binding53.26.7e-1770111447
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        T  E++l +d++++lG++ W++Ia++++ gRt++++k++w+++
  LOC_Os09g36250.1  70 LTDAEEQLVIDLHAKLGNR-WSKIAAKLP-GRTDNEIKNHWNTH 111
                       5899***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-20562IPR009057Homeodomain-like
PROSITE profilePS5129412.116961IPR017930Myb domain
SuperFamilySSF466891.4E-2611108IPR009057Homeodomain-like
SMARTSM007176.4E-111363IPR001005SANT/Myb domain
PfamPF002495.9E-141461IPR001005SANT/Myb domain
CDDcd001671.76E-81661No hitNo description
PROSITE profilePS5129428.03262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-2563117IPR009057Homeodomain-like
SMARTSM007172.2E-1566114IPR001005SANT/Myb domain
PfamPF002498.1E-1570111IPR001005SANT/Myb domain
CDDcd001672.00E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MGRQPCCDKL GVKRGPWTAE EDKKLMSFIL TNGHCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL TDAEEQLVID LHAKLGNRWS KIAAKLPGRT DNEIKNHWNT HIKKKLIKMG  120
IDPVTHEPLD RKQESPATTS QSTVTAESSK SGEATRQQSR QLDDAVVRDM SVSAGGDSPP  180
ESSTNTASTA GGSSSSSSSH HQDPLVKWLL EEDLLPTGDE PWLNFTASND VDEFSSIAAT  240
GATPALPWDV GMTTDWLLDY QDFGMGDSSL VVDASMVNSS NGSNF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27141167108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.216360.0callus| flower| leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379906460.0
Expression AtlasQ69SH8-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g36250.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g36250
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1117400.0AK111740.1 Oryza sativa Japonica Group cDNA clone:J023047I22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612209.10.0PREDICTED: protein ODORANT1
RefseqXP_015612208.10.0PREDICTED: protein ODORANT1
RefseqXP_015612207.10.0PREDICTED: protein ODORANT1
RefseqXP_015612206.10.0PREDICTED: protein ODORANT1
RefseqXP_015612205.10.0PREDICTED: protein ODORANT1
RefseqXP_015612204.10.0PREDICTED: protein ODORANT1
RefseqXP_015612203.10.0PREDICTED: protein ODORANT1
RefseqXP_015612201.10.0PREDICTED: protein ODORANT1
RefseqXP_015612200.10.0PREDICTED: protein ODORANT1
SwissprotQ50EX63e-95ODO1_PETHY; Protein ODORANT1
TrEMBLB8BDU70.0B8BDU7_ORYSI; Putative uncharacterized protein
TrEMBLI1QQP60.0I1QQP6_ORYGL; Uncharacterized protein
TrEMBLQ69SH80.0Q69SH8_ORYSJ; Os09g0532900 protein
STRINGBGIOSGA029380-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os09g36250.10.0(Oryza sativa Japonica Group)
STRINGORGLA09G0137500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12350.13e-87myb domain protein 42