PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g36160.1
Common NameLOC4347669, OJ1254_E07.16, Os09g0531600, OSNPB_090531600, P0515E01.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family SRS
Protein Properties Length: 316aa    MW: 32021.5 Da    PI: 8.754
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g36160.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702228.21.5e-70922423153
            DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssae 95 
                        g++sCqdCGnqakkdC+h+RCRtCCksrgf CathvkstWvpaakrrerqqqlaa++++aaa+a  a + r+ +++ +++ ++++ ++ss++
  LOC_Os09g36160.1  92 GGGISCQDCGNQAKKDCTHMRCRTCCKSRGFACATHVKSTWVPAAKRRERQQQLAALAASAAATAGGAGPSRDPTKRPRARPSATTPTTSSGD 184
                       5789********************************************************99999877777777778889999999999**** PP

            DUF702  96 skkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                       +++ + ++++P+evsseavfrcvr++ vd++e+e+aYqtavsigGhvfkGiL+d G+e
  LOC_Os09g36160.1 185 QQMVTVAERFPREVSSEAVFRCVRLGPVDQAEAEVAYQTAVSIGGHVFKGILHDVGPE 242
                       ********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051425.8E-6694242IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016235.4E-2796138IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016242.1E-22193241IPR006511Lateral Root Primordium type 1, C-terminal
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MAGFPLGGGS HSRDNPAPPV PPVHPADAAS FLYATRGGSF QLWQQQEQQP FYASNIIRFA  60
DDAPPAPSLA GASSSSSSRG MRSSGGGGGG GGGGISCQDC GNQAKKDCTH MRCRTCCKSR  120
GFACATHVKS TWVPAAKRRE RQQQLAALAA SAAATAGGAG PSRDPTKRPR ARPSATTPTT  180
SSGDQQMVTV AERFPREVSS EAVFRCVRLG PVDQAEAEVA YQTAVSIGGH VFKGILHDVG  240
PEALAVAGGG GASEYHFRLT GDGSSPSTAA AGEAGSGGGG NIIVSSAVVM DPYPTPGPYG  300
AFPAGTPFFH GHPRP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.89640.0callus| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2976098430.0
Expression AtlasQ652K4-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g36160.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g36160
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2412850.0AK241285.1 Oryza sativa Japonica Group cDNA, clone: J065137A19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611315.10.0PREDICTED: protein SHI RELATED SEQUENCE 1
TrEMBLA0A0E0IMR70.0A0A0E0IMR7_ORYNI; Uncharacterized protein
TrEMBLA0A0E0QU830.0A0A0E0QU83_ORYRU; Uncharacterized protein
TrEMBLA2Z3E00.0A2Z3E0_ORYSI; Putative uncharacterized protein
TrEMBLQ652K40.0Q652K4_ORYSJ; Os09g0531600 protein
STRINGBGIOSGA029388-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os09g36160.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18721140
MonocotsOGMP135435124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66350.19e-41Lateral root primordium (LRP) protein-related