PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g35910.1
Common NameHOX6, LOC4347647, OJ1439_F07.36, Os09g0528200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 250aa    MW: 27300.3 Da    PI: 5.6895
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g35910.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox611.8e-193183456
                      -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      + +f++eq++ Le++F+ + ++  +++ +LA++lgL+ rqV +WFqN+Ra++k
  LOC_Os09g35910.1 31 KKRFSEEQIKSLESMFATQTKLEPRQKLQLARELGLQPRQVAIWFQNKRARWK 83
                      456*************************************************9 PP

2HD-ZIP_I/II122.42.2e-3930121293
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       +k+r+s+eq+k+LE++F +++kLep++K +lareLglqprqva+WFqn+RAR+k+kqlE++y+aL++ ydal  + e+L+ke+ +L ++l++
  LOC_Os09g35910.1  30 RKKRFSEEQIKSLESMFATQTKLEPRQKLQLARELGLQPRQVAIWFQNKRARWKSKQLEREYSALRDDYDALLCSYESLKKEKLALIKQLEK 121
                       8**************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.27E-191987IPR009057Homeodomain-like
PROSITE profilePS5007117.1032585IPR001356Homeobox domain
SMARTSM003891.8E-162889IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.3E-202992IPR009057Homeodomain-like
CDDcd000861.04E-163086No hitNo description
PfamPF000467.9E-173183IPR001356Homeobox domain
PRINTSPR000318.3E-65665IPR000047Helix-turn-helix motif
PROSITE patternPS0002706083IPR017970Homeobox, conserved site
PRINTSPR000318.3E-66581IPR000047Helix-turn-helix motif
PfamPF021832.2E-1285127IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020104anatomyleaf sheath
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MDGEEDSEWM MMDVGGKGGK GGGGGGAADR KKRFSEEQIK SLESMFATQT KLEPRQKLQL  60
ARELGLQPRQ VAIWFQNKRA RWKSKQLERE YSALRDDYDA LLCSYESLKK EKLALIKQLE  120
KLAEMLQEPR GKYGDNAGDD ARSGGVAGMK KEEFVGAGGA ATLYSSAEGG GTTTTTTAKL  180
MPHFGSDDVD AGLFLRPSSQ HHPPPPHAGA GFTSSEPAAD HQSFNFHSSW PSSTEQTCSS  240
TPWWEFESE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11725GGKGGGGGG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.1003100.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1172399830.0
Expression AtlasQ651Z5-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, leaves, nodes, internodes, flowers and embryo. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. {ECO:0000269|PubMed:10732669}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00650PBM25215497Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g35910.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
IntActSearch Q651Z5
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g35910
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8308470.0CT830847.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN030P03, full insert sequence.
GenBankAK1031600.0AK103160.1 Oryza sativa Japonica Group cDNA clone:J033121C04, full insert sequence.
GenBankAK0597550.0AK059755.1 Oryza sativa Japonica Group cDNA clone:006-203-C03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612316.10.0PREDICTED: homeobox-leucine zipper protein HOX6
SwissprotQ651Z50.0HOX6_ORYSJ; Homeobox-leucine zipper protein HOX6
SwissprotQ9XH350.0HOX6_ORYSI; Homeobox-leucine zipper protein HOX6
TrEMBLA0A0E0M3Q21e-154A0A0E0M3Q2_ORYPU; Uncharacterized protein
STRINGLOC_Os09g35910.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
MonocotsOGMP78733448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.13e-43homeobox 7
Publications ? help Back to Top
  1. Meijer AH,de Kam RJ,d'Erfurth I,Shen W,Hoge JH
    HD-Zip proteins of families I and II from rice: interactions and functional properties.
    Mol. Gen. Genet., 2000. 263(1): p. 12-21
    [PMID:10732669]
  2. Cooper B, et al.
    A network of rice genes associated with stress response and seed development.
    Proc. Natl. Acad. Sci. U.S.A., 2003. 100(8): p. 4945-50
    [PMID:12684538]
  3. Agalou A, et al.
    A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members.
    Plant Mol. Biol., 2008. 66(1-2): p. 87-103
    [PMID:17999151]