PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g35790.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HSF
Protein Properties Length: 104aa    MW: 11218.4 Da    PI: 4.1541
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g35790.3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind85.85.9e-273997260
                      HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
      HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
                      Fl+k+y+++ed++++++isw+e+g++fvv+ + efa+++LpkyFkh+nf+SFvRQLn+Y
  LOC_Os09g35790.3 39 FLTKTYQLVEDPAVDDVISWNEDGSTFVVWRPAEFARDLLPKYFKHNNFSSFVRQLNTY 97
                      9********************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.101.9E-283197IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004155.9E-2335101IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467855.78E-253698IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004477.0E-233997IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.3E-163962IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.3E-167789IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.3E-1690102IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 104 aa     Download sequence    Send to blast
MAEQGAGEAD AGGGEPPPAA VMTAAAEALA GQRSLPTPFL TKTYQLVEDP AVDDVISWNE  60
DGSTFVVWRP AEFARDLLPK YFKHNNFSSF VRQLNTYPND GTW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ldu_A7e-1929971178Heat shock factor protein 1
5d5v_D9e-1930972187Heat shock factor protein 1
5d5v_B9e-1930972187Heat shock factor protein 1
5d5u_B9e-1930972187Heat shock factor protein 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.119411e-159callus| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329917541e-159
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00432DAPTransfer from AT4G11660Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g35790.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g35790
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126171e-162CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
GenBankAP0149651e-162AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankAP0056811e-162AP005681.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OJ1439_F07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612527.14e-64PREDICTED: heat stress transcription factor B-2c isoform X2
SwissprotQ652B03e-65HFB2C_ORYSJ; Heat stress transcription factor B-2c
TrEMBLA0A0E0QU386e-64A0A0E0QU38_ORYRU; Uncharacterized protein
TrEMBLA2Z3A96e-64A2Z3A9_ORYSI; Putative uncharacterized protein
TrEMBLB8AMF09e-66B8AMF0_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA011509-PA2e-65(Oryza sativa Indica Group)
STRINGBGIOSGA029403-PA2e-63(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11660.15e-40HSF family protein