PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g35760.2
Common NameGL2-6, Os09g0526300, ROC6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 872aa    MW: 91592.1 Da    PI: 6.03
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g35760.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.22.1e-21123178156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe++F+++++p++++r eL+++l+L+ rqVk+WFqNrR+++k
  LOC_Os09g35760.2 123 KKRYHRHTPQQIQELEAVFKECPHPDEKQRMELSRRLNLESRQVKFWFQNRRTQMK 178
                       688999***********************************************999 PP

2START177.57.8e-563485781205
                       HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEE CS
             START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kae 80 
                       ela++a++elvk a+ +ep+W  s     e +n+de+ + f++  +     + +ea r+sg+ +  +++lv +l+d + +W+e+++    +a+
  LOC_Os09g35760.2 348 ELALAAMDELVKVAQMDEPLWLPSLdggfETLNYDEYHRAFARVVGqcpagYVSEATRESGIAIISSVDLVDSLMDAP-RWSEMFPcvvaRAS 439
                       5899*************************************8866699******************************.************** PP

                       EEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--........-TTSEE-EESSEEEEEEEECT CS
             START  81 tlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.......sssvvRaellpSgiliepksn 159
                       t++ issg      g +qlm aelq+lsplvp R++vf+R+++q+ +g w++vdvSvd    p +       sss++ ++llp+g++++++ n
  LOC_Os09g35760.2 440 TTDIISSGmggtrsGSIQLMHAELQVLSPLVPiREVVFLRFCKQHAEGLWAVVDVSVDAVLRPDQnggggssSSSYMGCRLLPTGCIVQDMNN 532
                       **********************************************************988877667788889******************** PP

                       CEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
             START 160 ghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                       g+skvtwv h+++++   h+l+r+l++sg+a ga++w+a lqrqc+
  LOC_Os09g35760.2 533 GYSKVTWVVHAEYDETAAHQLYRPLLRSGQALGARRWLASLQRQCQ 578
                       *********************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.14E-22105180IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-23110180IPR009057Homeodomain-like
PROSITE profilePS5007118.301120180IPR001356Homeobox domain
SMARTSM003891.5E-19121184IPR001356Homeobox domain
CDDcd000861.04E-19123180No hitNo description
PfamPF000466.5E-19123178IPR001356Homeobox domain
PROSITE patternPS000270155178IPR017970Homeobox, conserved site
PROSITE profilePS5084841.927339582IPR002913START domain
SuperFamilySSF559616.92E-30343578No hitNo description
PfamPF018523.9E-47348578IPR002913START domain
SMARTSM002343.3E-39348579IPR002913START domain
CDDcd088758.93E-99354578No hitNo description
SuperFamilySSF559613.85E-14598794No hitNo description
SuperFamilySSF559613.85E-14822853No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020048anatomymicrospore
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 872 aa     Download sequence    Send to blast
MSFGGMFDGA GSGVFSYDAG GGGGGGGVHN SRLLPTPPVP KPGGGFAAPG LSLGLQTMDG  60
SQLGDVNRSL AMMGNGGSGS GGDGDSLGRG REEENDSRSG SDNLDGASGD ELDPDNSNPR  120
KKKKRYHRHT PQQIQELEAV FKECPHPDEK QRMELSRRLN LESRQVKFWF QNRRTQMKTQ  180
IERHENALLR QENDKLRAEN MTIREAMRNP MCASCGGAAV LGEVSLEEQH LRIENARLKD  240
ELDRVCALAG KFLGRPISSI SSPGPPSLQA CSGLELGVGS NGGFGLGALG ASAAMQSIPD  300
LMGGSSGLTG GPVGSAAMRL PAGIGGLDGA MHAAAADGGA IDRAVLLELA LAAMDELVKV  360
AQMDEPLWLP SLDGGFETLN YDEYHRAFAR VVGQCPAGYV SEATRESGIA IISSVDLVDS  420
LMDAPRWSEM FPCVVARAST TDIISSGMGG TRSGSIQLMH AELQVLSPLV PIREVVFLRF  480
CKQHAEGLWA VVDVSVDAVL RPDQNGGGGS SSSSYMGCRL LPTGCIVQDM NNGYSKVTWV  540
VHAEYDETAA HQLYRPLLRS GQALGARRWL ASLQRQCQYL AILCSNSLPA RDHAAITPVG  600
RRSMLKLAQR MTDNFCAGVC ASAAQKWRRL DEWRGEGGGG GGGGGGDGED KVRMMARHSV  660
GAPGEPPGVV LSATTSVRLP GTLPQRVFDY LRDEQRRGDW DILANGEAMQ EMDHIAKGQH  720
HGNAVSLLRP NATSGNQNNM LILQETCTDS SGSLVVYAPV DVQSMHVVMN GGDSAYVSLL  780
PSGFAILPDG HNNGASPSPA EVGSGASPNS AAGGGGGSNN TGSLVTVAFQ ILVNNLPTAK  840
LTVESVDTVS NLLSCTIQKI KSALQASIIS P*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1119124RKKKKR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.574140.0callus| flower| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329819000.0
Expression AtlasQ7Y0V7-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g35760.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g35760
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612621.10.0PREDICTED: homeobox-leucine zipper protein ROC6
SwissprotQ7Y0V70.0ROC6_ORYSJ; Homeobox-leucine zipper protein ROC6
TrEMBLA0A0E0M3M50.0A0A0E0M3M5_ORYPU; Uncharacterized protein
STRINGLOC_Os09g35760.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein