PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g35760.1
Common NameGL2-6, Os09g0526300, ROC6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 873aa    MW: 91720.2 Da    PI: 6.03
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g35760.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.22.1e-21123179157
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                       +++ +++t++q++eLe++F+++++p++++r eL+++l+L+ rqVk+WFqNrR+++k+
  LOC_Os09g35760.1 123 KKRYHRHTPQQIQELEAVFKECPHPDEKQRMELSRRLNLESRQVKFWFQNRRTQMKQ 179
                       688999************************************************996 PP

2START177.57.8e-563495791205
                       HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEE CS
             START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kae 80 
                       ela++a++elvk a+ +ep+W  s     e +n+de+ + f++  +     + +ea r+sg+ +  +++lv +l+d + +W+e+++    +a+
  LOC_Os09g35760.1 349 ELALAAMDELVKVAQMDEPLWLPSLdggfETLNYDEYHRAFARVVGqcpagYVSEATRESGIAIISSVDLVDSLMDAP-RWSEMFPcvvaRAS 440
                       5899*************************************8866699******************************.************** PP

                       EEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--........-TTSEE-EESSEEEEEEEECT CS
             START  81 tlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.......sssvvRaellpSgiliepksn 159
                       t++ issg      g +qlm aelq+lsplvp R++vf+R+++q+ +g w++vdvSvd    p +       sss++ ++llp+g++++++ n
  LOC_Os09g35760.1 441 TTDIISSGmggtrsGSIQLMHAELQVLSPLVPiREVVFLRFCKQHAEGLWAVVDVSVDAVLRPDQnggggssSSSYMGCRLLPTGCIVQDMNN 533
                       **********************************************************988877667788889******************** PP

                       CEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
             START 160 ghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                       g+skvtwv h+++++   h+l+r+l++sg+a ga++w+a lqrqc+
  LOC_Os09g35760.1 534 GYSKVTWVVHAEYDETAAHQLYRPLLRSGQALGARRWLASLQRQCQ 579
                       *********************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.21E-22105181IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-23110180IPR009057Homeodomain-like
PROSITE profilePS5007118.317120180IPR001356Homeobox domain
SMARTSM003895.0E-19121184IPR001356Homeobox domain
CDDcd000869.53E-20123181No hitNo description
PfamPF000466.2E-19123179IPR001356Homeobox domain
PROSITE patternPS000270155178IPR017970Homeobox, conserved site
PROSITE profilePS5084841.927340583IPR002913START domain
SuperFamilySSF559616.92E-30344579No hitNo description
PfamPF018523.9E-47349579IPR002913START domain
SMARTSM002343.3E-39349580IPR002913START domain
CDDcd088758.82E-99355579No hitNo description
SuperFamilySSF559613.85E-14599795No hitNo description
SuperFamilySSF559613.85E-14823854No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020048anatomymicrospore
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 873 aa     Download sequence    Send to blast
MSFGGMFDGA GSGVFSYDAG GGGGGGGVHN SRLLPTPPVP KPGGGFAAPG LSLGLQTMDG  60
SQLGDVNRSL AMMGNGGSGS GGDGDSLGRG REEENDSRSG SDNLDGASGD ELDPDNSNPR  120
KKKKRYHRHT PQQIQELEAV FKECPHPDEK QRMELSRRLN LESRQVKFWF QNRRTQMKQT  180
QIERHENALL RQENDKLRAE NMTIREAMRN PMCASCGGAA VLGEVSLEEQ HLRIENARLK  240
DELDRVCALA GKFLGRPISS ISSPGPPSLQ ACSGLELGVG SNGGFGLGAL GASAAMQSIP  300
DLMGGSSGLT GGPVGSAAMR LPAGIGGLDG AMHAAAADGG AIDRAVLLEL ALAAMDELVK  360
VAQMDEPLWL PSLDGGFETL NYDEYHRAFA RVVGQCPAGY VSEATRESGI AIISSVDLVD  420
SLMDAPRWSE MFPCVVARAS TTDIISSGMG GTRSGSIQLM HAELQVLSPL VPIREVVFLR  480
FCKQHAEGLW AVVDVSVDAV LRPDQNGGGG SSSSSYMGCR LLPTGCIVQD MNNGYSKVTW  540
VVHAEYDETA AHQLYRPLLR SGQALGARRW LASLQRQCQY LAILCSNSLP ARDHAAITPV  600
GRRSMLKLAQ RMTDNFCAGV CASAAQKWRR LDEWRGEGGG GGGGGGGDGE DKVRMMARHS  660
VGAPGEPPGV VLSATTSVRL PGTLPQRVFD YLRDEQRRGD WDILANGEAM QEMDHIAKGQ  720
HHGNAVSLLR PNATSGNQNN MLILQETCTD SSGSLVVYAP VDVQSMHVVM NGGDSAYVSL  780
LPSGFAILPD GHNNGASPSP AEVGSGASPN SAAGGGGGSN NTGSLVTVAF QILVNNLPTA  840
KLTVESVDTV SNLLSCTIQK IKSALQASII SP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1119124RKKKKR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.574140.0callus| flower| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329819000.0
Expression AtlasQ7Y0V7-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g35760.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g35760
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612621.10.0PREDICTED: homeobox-leucine zipper protein ROC6
SwissprotQ7Y0V70.0ROC6_ORYSJ; Homeobox-leucine zipper protein ROC6
TrEMBLA0A0E0M3M50.0A0A0E0M3M5_ORYPU; Uncharacterized protein
STRINGLOC_Os09g35760.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein