PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g35020.1
Common NameDREB1H, ERF133, LOC4347619, Os09g0522100, OSJNOa273B05.9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family ERF
Protein Properties Length: 247aa    MW: 25491.2 Da    PI: 5.1038
Description ERF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g35020.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP255.71.2e-174597155
               AP2  1 sgykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkleg 55
                      + y+GVr++   grWv+e+r+p ++g  +r +lg++ tae Aa+a++aa+ +l+g
  LOC_Os09g35020.1 45 PVYRGVRRRGGAGRWVCEVRVPGKRG--ARLWLGTYVTAEAAARAHDAAMIALRG 97
                      68*******************95544..*************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008475.4E-134597IPR001471AP2/ERF domain
SMARTSM003801.5E-1646116IPR001471AP2/ERF domain
Gene3DG3DSA:3.30.730.107.0E-2646112IPR001471AP2/ERF domain
SuperFamilySSF541719.15E-1646111IPR016177DNA-binding domain
PROSITE profilePS5103220.8546110IPR001471AP2/ERF domain
PRINTSPR003674.6E-54758IPR001471AP2/ERF domain
PRINTSPR003674.6E-57187IPR001471AP2/ERF domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020048anatomymicrospore
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MDMAGHEVNS SSSSSGAESS SSSSGRQQYK KRPAGRTKFR ETRHPVYRGV RRRGGAGRWV  60
CEVRVPGKRG ARLWLGTYVT AEAAARAHDA AMIALRGGAG GGGAACLNFQ DSAWLLAVPP  120
AAPSDLAGVR RAATEAVAGF LQRNKTTNGA SVAEAMDEAT SGVSAPPPLA NNAGSSETPG  180
PSSIDGTADT AAGAALDMFE LDFFGEMDYD TYYASLAEGL LMEPPPAATA LWDNGDEGAD  240
IALWSY*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.829530.0panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154802340.0
Expression AtlasQ0J090-
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]CCGAC-3'. Binding to the C-repeat/DRE element mediates high salinity- and dehydration-inducible transcription (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g35020.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g35020
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126170.0CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankAP0068590.0AP006859.1 Oryza sativa Japonica Group genomic DNA, chromosome 9, fosmid clone:OSJNOa273B05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611305.11e-178PREDICTED: dehydration-responsive element-binding protein 1H
SwissprotA2Z3881e-180DRE1H_ORYSI; Dehydration-responsive element-binding protein 1H
SwissprotQ0J0901e-180DRE1H_ORYSJ; Dehydration-responsive element-binding protein 1H
TrEMBLI1QQK21e-177I1QQK2_ORYGL; Uncharacterized protein
STRINGBGIOSGA029416-PA1e-178(Oryza sativa Indica Group)
STRINGLOC_Os09g35020.11e-178(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6456520
MonocotsOGMP19636261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25470.11e-19C-repeat/DRE binding factor 2
Publications ? help Back to Top
  1. Skinner JS, et al.
    Structural, functional, and phylogenetic characterization of a large CBF gene family in barley.
    Plant Mol. Biol., 2005. 59(4): p. 533-51
    [PMID:16244905]
  2. Nakano T,Suzuki K,Fujimura T,Shinshi H
    Genome-wide analysis of the ERF gene family in Arabidopsis and rice.
    Plant Physiol., 2006. 140(2): p. 411-32
    [PMID:16407444]