PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g34950.1
Common NameLOC107276766, Os09g0521300, OsJ_17424, OSNPB_090521300, P0669G04.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family TCP
Protein Properties Length: 382aa    MW: 38771.1 Da    PI: 4.76
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g34950.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP103.24.3e-32122210594
               TCP   5 kdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaksa 94 
                         r+ ++h kv+gR+RR+R++++caar+ +L++eLG+++d++ti WL+qq++pai ++tgt++ +a ++ +++ +    ++s ++aa+ +
  LOC_Os09g34950.1 122 PPRNRDRHVKVEGRGRRIRMPVNCAARIAQLTRELGHKSDGETIRWLMQQSEPAIVAATGTGTVPAIAT-TVDGVLRIPTESPSAAARGD 210
                       5799*********************************************************99999444.44444444433333333332 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036345.2E-26125204IPR005333Transcription factor, TCP
PROSITE profilePS5136925.128125179IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MASQLQGKGA ETAAAGERVA PGTNAAAFAG LGYPPIQSPV ALQEEEGPRD AAFAGYAPIR  60
SPVVSRLQEK GEGEGEEEEV DKREEAGMAA DGSAFAAGMA LVPKPEPVAV EFLRGLAVAK  120
PPPRNRDRHV KVEGRGRRIR MPVNCAARIA QLTRELGHKS DGETIRWLMQ QSEPAIVAAT  180
GTGTVPAIAT TVDGVLRIPT ESPSAAARGD EPAPKRRRKL QPTRAAAGGP VEALAAAPPP  240
AVYYPIVADP LLQANGGGSI SISSGLAPAS SATPPTATGG GAIPFIAMPA TSDGGKQAMS  300
PATVWMVPPG GAGAVNQPIQ YWAFQPNPDH ANFAGASSYN VGQNPGVHEA SAADHAASTG  360
GGGGGEDDEY EGMTDSSSDE E*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1213219PKRRRKL
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ650T3
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g34950.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g34950
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankAP0061750.0AP006175.2 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0669G04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612634.10.0PREDICTED: transcription factor PCF2-like
SwissprotA2YXQ11e-84PCF2_ORYSI; Transcription factor PCF2
SwissprotQ6ZBH61e-84PCF2_ORYSJ; Transcription factor PCF2
TrEMBLA2Z3800.0A2Z380_ORYSI; Putative uncharacterized protein
TrEMBLQ650T30.0Q650T3_ORYSJ; Os09g0521300 protein
STRINGBGIOSGA029420-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os09g34950.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP31781129
MonocotsOGMP39123167
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.11e-41TCP family protein