PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g34060.1
Common NameLOC4347578, Os09g0516200, OSJNBb0034B12.8, P0450E05.33, RF2a
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 381aa    MW: 40647.5 Da    PI: 6.6549
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g34060.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.91.4e-10183241563
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                       kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l  l+   + l++e+
  LOC_Os09g34060.1 183 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATTLSAQLALLQRDTSGLTTEN 241
                       9*********************************************9999888888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.1E-16179243IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.898181244IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.7E-10183238No hitNo description
PfamPF001702.5E-9183241IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.2E-10183234No hitNo description
CDDcd147038.82E-23184233No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025281anatomypollen
PO:0001015developmental stageK second mitotic division stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MNREKSPIPG DGGDGLPPQA TRRAGPPAAA AAAEYDISRM PDFPTRNPGH RRAHSEILSL  60
PEDLDLCAAG GGDGPSLSDE NDEELFSMFL DVEKLNSTCG ASSEAEAESS SAGAAAAVAA  120
AAAAAAHGAR PKHQHSLSMD ESMSIKAEEL VGASPGTEGM SSAEAKKAVS AAKLAELALV  180
DPKRAKRIWA NRQSAARSKE RKMRYIAELE RKVQTLQTEA TTLSAQLALL QRDTSGLTTE  240
NSELKLRLQT MEQQVHLQDA LNDTLKSEVQ RLKVATGQMA NGGGMMMNFG GMPHQFGGNQ  300
QMFQNNQAMQ SMLAAHQLQQ LQLHPQAQQQ QVLHPQHQQQ QPLHPLQAQQ LQQAARDLKM  360
KSPMGGQSQW GDGKSGSSGN *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.542500.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329880040.0
Expression AtlasQ69IL4-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed at high levels in levels in leaf sheath, moderate levels in leaf blade, but not in roots. Predominantly expressed in vascular tissues. {ECO:0000269|PubMed:14704272, ECO:0000269|PubMed:9311985}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269|PubMed:11390974, ECO:0000269|PubMed:12855676, ECO:0000269|PubMed:14704272, ECO:0000269|PubMed:9311985}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAPTransfer from AT1G06070Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g34060.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g34060
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1027950.0AK102795.1 Oryza sativa Japonica Group cDNA clone:J033108B13, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612692.10.0PREDICTED: transcription factor RF2a
SwissprotQ69IL40.0RF2A_ORYSJ; Transcription factor RF2a
TrEMBLA2Z3420.0A2Z342_ORYSI; Putative uncharacterized protein
STRINGLOC_Os09g34060.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12617181
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-63bZIP family protein
Publications ? help Back to Top
  1. Petruccelli S, et al.
    Transcription factor RF2a alters expression of the rice tungro bacilliform virus promoter in transgenic tobacco plants.
    Proc. Natl. Acad. Sci. U.S.A., 2001. 98(13): p. 7635-40
    [PMID:11390974]
  2. Zhu Q,Ordiz MI,Dabi T,Beachy RN,Lamb C
    Rice TATA binding protein interacts functionally with transcription factor IIB and the RF2a bZIP transcriptional activator in an enhanced plant in vitro transcription system.
    Plant Cell, 2002. 14(4): p. 795-803
    [PMID:11971135]
  3. Dai S, et al.
    Functional analysis of RF2a, a rice transcription factor.
    J. Biol. Chem., 2003. 278(38): p. 36396-402
    [PMID:12855676]
  4. Dai S,Zhang Z,Chen S,Beachy RN
    RF2b, a rice bZIP transcription activator, interacts with RF2a and is involved in symptom development of rice tungro disease.
    Proc. Natl. Acad. Sci. U.S.A., 2004. 101(2): p. 687-92
    [PMID:14704272]
  5. Yin Y,Zhu Q,Dai S,Lamb C,Beachy RN
    RF2a, a bZIP transcriptional activator of the phloem-specific rice tungro bacilliform virus promoter, functions in vascular development.
    EMBO J., 1997. 16(17): p. 5247-59
    [PMID:9311985]