PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g33550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family CO-like
Protein Properties Length: 472aa    MW: 50590.2 Da    PI: 6.7682
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g33550.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box16.71.6e-05543537
          zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg.......H 37
                       C+ ++e  + l+C+ +   lC  C  + H g       H
  LOC_Os09g33550.1  5 SCDYCGEAAAALHCRADAARLCVACDRHVH-GanalsrrH 43
                      7******99*******************99.435555556 PP

2CCT64.14e-22417460144
               CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                       R++a++RY+eKrktR+++K+irYesRK +A++R RvKGrFv+++
  LOC_Os09g33550.1 417 RDNAMQRYREKRKTRRYDKHIRYESRKMRADTRTRVKGRFVRAT 460
                       899**************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003364.7E-11148IPR000315B-box-type zinc finger
CDDcd000211.31E-8448No hitNo description
PROSITE profilePS501199.499648IPR000315B-box-type zinc finger
PROSITE profilePS5101715.239417459IPR010402CCT domain
PfamPF062036.7E-16417459IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
MTWRSCDYCG EAAAALHCRA DAARLCVACD RHVHGANALS RRHVRAPLCA RCEARPAAAR  60
VAAVAGAGGC GGGGEARFLC AGCADDDGAE AARVPVVGFS GCPGAAELAA SWGLDLGGGG  120
GRDEFEEDPF FPEAGYPMLA ADRVLRDMYV PCDPPPEVAA GGRGRRLKGD SLCHQLAELA  180
RREMESAPAQ ANSGSISPSA RRGSAAAIRH EAAAAAAAQR ATLPYKSTPV TEAAGCGDVG  240
NGEQFTDDNE LVWQRTAPSD PPCQIWDFNL GKSRDHDEHS ALELHFGPKD GGFMIKSYND  300
MIEEVSSSSR KDLQYIYDST YSFATEDIVS ANIYQLTPKQ LSTATSGNRR HKNEQHGLTN  360
DGPSSSRIVD VDRTLNSSPE EVAAVLAGEN CITDQTVTGA DQRNSLKIDS KTIAMNRDNA  420
MQRYREKRKT RRYDKHIRYE SRKMRADTRT RVKGRFVRAT DIFNVGGGDG G*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.878830.0leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379902120.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g33550.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g33550
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1205890.0AK120589.1 Oryza sativa Japonica Group cDNA clone:J013145I18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015610775.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 14
TrEMBLA0A0E0IM730.0A0A0E0IM73_ORYNI; Uncharacterized protein
STRINGLOC_Os09g33550.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5453813
MonocotsOGMP45042026
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33500.18e-33B-box type zinc finger protein with CCT domain