PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g32948.1
Common NameLOC4347517, MADS24, MADS8, Os09g0507200, OsJ_29947
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 249aa    MW: 28527.5 Da    PI: 9.2052
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g32948.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.81.1e-31959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  LOC_Os09g32948.1  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
                      79***********************************************96 PP

2K-box96.93.1e-32851769100
             K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                       +e++  +s+++e+ kLk+++enLqr+qR+llGedL++L +keL+qLe+qL++sl++iRs++++++l+q+ +lq++e++l e+nk+Lr+klee
  LOC_Os09g32948.1  85 KENELVQSSRNEYLKLKARVENLQRTQRNLLGEDLGTLGIKELEQLEKQLDSSLRHIRSTRTQHMLDQLTDLQRREQMLCEANKCLRRKLEE 176
                       45667899*********************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.4E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.137161IPR002100Transcription factor, MADS-box
CDDcd002651.39E-44277No hitNo description
SuperFamilySSF554551.96E-33288IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004049.0E-33323IPR002100Transcription factor, MADS-box
PfamPF003192.3E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004049.0E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004049.0E-333859IPR002100Transcription factor, MADS-box
PfamPF014865.8E-2687174IPR002487Transcription factor, K-box
PROSITE profilePS5129715.30190180IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0048481Biological Processplant ovule development
GO:0048833Biological Processspecification of floral organ number
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCSG  60
QSMTRTLERY QKFSYGGPDT AIQNKENELV QSSRNEYLKL KARVENLQRT QRNLLGEDLG  120
TLGIKELEQL EKQLDSSLRH IRSTRTQHML DQLTDLQRRE QMLCEANKCL RRKLEESNQL  180
HGQVWEHGAT LLGYERQSPH AVQQVPPHGG NGFFHSLEAA AEPTLQIGFT PEQMNNSCVT  240
AFMPTWLP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A6e-33751741101Developmental protein SEPALLATA 3
4ox0_B6e-33751741101Developmental protein SEPALLATA 3
4ox0_C6e-33751741101Developmental protein SEPALLATA 3
4ox0_D6e-33751741101Developmental protein SEPALLATA 3
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ9SAR1
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at early stage of flower development in the spikelet (rice flower) primordia and later in stamen and pistil primordia. Expressed during ovule development in the inner and outer integuments. {ECO:0000269|PubMed:12395189, ECO:0000269|PubMed:9065695}.
UniprotTISSUE SPECIFICITY: Expressed in lodicules, stamens and carpels. {ECO:0000269|PubMed:12395189, ECO:0000269|PubMed:9065695, ECO:0000269|PubMed:9339904}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. May be involved in the control of flowering time. {ECO:0000269|PubMed:9339904, ECO:0000269|Ref.9}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00605ChIP-seqTransfer from AT1G24260Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g32948.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9SAR1
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g32948
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ7509360.0FJ750936.1 Oryza sativa clone KCS108B10 MADS-box transcription factor 8 mRNA, complete cds.
GenBankAK0728670.0AK072867.1 Oryza sativa Japonica Group cDNA clone:J023143P16, full insert sequence.
GenBankOSU788920.0U78892.1 Oryza sativa MADS box protein (OsMADS8) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015610824.10.0PREDICTED: MADS-box transcription factor 8
SwissprotQ9SAR10.0MADS8_ORYSJ; MADS-box transcription factor 8
TrEMBLD3U2G80.0D3U2G8_ORYSA; MADS-box transcription factor 8
STRINGLOC_Os09g32948.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
MonocotsOGMP34833469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.15e-93MIKC_MADS family protein
Publications ? help Back to Top
  1. Moon YH, et al.
    Determination of the motif responsible for interaction between the rice APETALA1/AGAMOUS-LIKE9 family proteins using a yeast two-hybrid system.
    Plant Physiol., 1999. 120(4): p. 1193-204
    [PMID:10444103]
  2. Favaro R, et al.
    Ovule-specific MADS-box proteins have conserved protein-protein interactions in monocot and dicot plants.
    Mol. Genet. Genomics, 2002. 268(2): p. 152-9
    [PMID:12395189]
  3. Cooper B, et al.
    A network of rice genes associated with stress response and seed development.
    Proc. Natl. Acad. Sci. U.S.A., 2003. 100(8): p. 4945-50
    [PMID:12684538]
  4. Lee S, et al.
    Alteration of floral organ identity in rice through ectopic expression of OsMADS16.
    Planta, 2003. 217(6): p. 904-11
    [PMID:12905025]
  5. Fornara F, et al.
    Functional characterization of OsMADS18, a member of the AP1/SQUA subfamily of MADS box genes.
    Plant Physiol., 2004. 135(4): p. 2207-19
    [PMID:15299121]
  6. Greco R, et al.
    MADS box genes expressed in developing inflorescences of rice and sorghum.
    Mol. Gen. Genet., 1997. 253(5): p. 615-23
    [PMID:9065695]
  7. Kang HG,Jang S,Chung JE,Cho YG,An G
    Characterization of two rice MADS box genes that control flowering time.
    Mol. Cells, 1997. 7(4): p. 559-66
    [PMID:9339904]