PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g32944.1
Common NameLOC4347516, Os09g0507100, SPL18
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family SBP
Protein Properties Length: 473aa    MW: 49646.2 Da    PI: 7.5624
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g32944.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.31.4e-40115191278
                       -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
               SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                       C v+gC+adls+ ++yhrrhkvCe hsk+pvv+vsg+e rfCqqCsrfh l efDe+krsCr+rL++hn+rrrk+qa
  LOC_Os09g32944.1 115 CAVDGCKADLSKHRDYHRRHKVCEPHSKTPVVVVSGREMRFCQQCSRFHLLGEFDEAKRSCRKRLDGHNRRRRKPQA 191
                       **************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.3E-36107176IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.923112189IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.35E-38113194IPR004333Transcription factor, SBP-box
PfamPF031101.2E-31115188IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009037anatomylemma
PO:0001047developmental stagelemma development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MDWDLKMPVS WDLAELEHNA VPNMAAAASA AEPGIAAVAA SRGAPGRPEC SVDLKLGGLG  60
EFGAADALKE PAAAAKAPVS SAAAAASVAK VPPSTSTLKR PRGGGGGGGG QCPSCAVDGC  120
KADLSKHRDY HRRHKVCEPH SKTPVVVVSG REMRFCQQCS RFHLLGEFDE AKRSCRKRLD  180
GHNRRRRKPQ ADSMSSGSFM TSQQGTRFAS FTPPRPEPSW PGIIKSEETP YYSHHHHPHP  240
VMTSRQPHFV GSPSSATTAA FSPKEGRRFP FLHEGDQISF GGGGGAAAAA TLEISVCQTT  300
VVAPPPPESS SSNKMFSSDG LTTATTTTTT AHHHHHHHQV LDSDCALSLL SSPANSSSVD  360
VSRMVQPSPA AAAGAEHHHH HQIPMAQPLV PNLQQQFGGS SPWFASSPAA AAVAGGGFAC  420
PSMDSEQQQQ QQLNAVLVPG SNENEMNYHG MFHVGGEGSS DGTSPSLPFS WQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-27105188184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1171188KRSCRKRLDGHNRRRRKP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.561579e-85panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329946789e-85
Expression AtlasQ0J0K1-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young panicles. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g32944.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g32944
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1087590.0AC108759.2 Oryza sativa (Japonica cultiva-group) chromosome 9 BAC clone OSJNBa0072P02, complete sequence.
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015610874.10.0PREDICTED: squamosa promoter-binding-like protein 18 isoform X2
SwissprotQ0J0K10.0SPL18_ORYSJ; Squamosa promoter-binding-like protein 18
TrEMBLA0A0E0B5180.0A0A0E0B518_9ORYZ; Uncharacterized protein
STRINGLOC_Os09g32944.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9717230
MonocotsOGMP17553795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.16e-39SBP family protein
Publications ? help Back to Top
  1. Xie K,Wu C,Xiong L
    Genomic organization, differential expression, and interaction of SQUAMOSA promoter-binding-like transcription factors and microRNA156 in rice.
    Plant Physiol., 2006. 142(1): p. 280-93
    [PMID:16861571]
  2. Yang Z, et al.
    Comparative study of SBP-box gene family in Arabidopsis and rice.
    Gene, 2008. 407(1-2): p. 1-11
    [PMID:17629421]