PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g32260.2
Common NameLOC4347465, Os09g0497900, OsJ_29886, OSNPB_090497900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 353aa    MW: 39127.7 Da    PI: 9.6575
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g32260.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.77.8e-56211511128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdeel+++yL++k+++  +++ ++i+evd++k+ePwdLp+k+k +ekewyfFs rd+ky+tg r+nrat++gyWk+tgkdke++
  LOC_Os09g32260.2  21 LPPGFRFHPTDEELITYYLRQKIADGGFTA-RAIAEVDLNKCEPWDLPEKAKMGEKEWYFFSLRDRKYPTGVRTNRATNAGYWKTTGKDKEIF 112
                       79*************************999.89***************99999**************************************** PP

               NAM  94 sk....kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +     + elvg+kktLvfykgrap+gekt+Wvmheyrl
  LOC_Os09g32260.2 113 TGqppaTPELVGMKKTLVFYKGRAPRGEKTNWVMHEYRL 151
                       9766666677***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-6417172IPR003441NAC domain
PROSITE profilePS5100560.86321172IPR003441NAC domain
PfamPF023652.3E-2922151IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MAMGMEGSGG GGSAKKKEES LPPGFRFHPT DEELITYYLR QKIADGGFTA RAIAEVDLNK  60
CEPWDLPEKA KMGEKEWYFF SLRDRKYPTG VRTNRATNAG YWKTTGKDKE IFTGQPPATP  120
ELVGMKKTLV FYKGRAPRGE KTNWVMHEYR LHSKSIPKSN KDEWVVCRIF AKTAGVKKYP  180
SNNAHSRSHH PYTLDMVPPL LPALLQQDPF GRGHHPYMNP VDMAELSRFA RGTPGLHPHI  240
QPHPGYINPA APFTLSGLNL NLGSSPAMPP PPPPPPQSIL QAMSMPMNQP RSTTNQVMVT  300
EQMIPGLANG VIPQGTDGGF TTDVVVGGTG IRYQNLDVEQ LVERYWPGSY QM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-552017816171NO APICAL MERISTEM PROTEIN
1ut4_B1e-552017816171NO APICAL MERISTEM PROTEIN
1ut7_A1e-552017816171NO APICAL MERISTEM PROTEIN
1ut7_B1e-552017816171NO APICAL MERISTEM PROTEIN
4dul_A1e-552017816171NAC domain-containing protein 19
4dul_B1e-552017816171NAC domain-containing protein 19
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ0J0J0
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00277DAPTransfer from AT2G24430Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g32260.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g32260
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1025110.0AK102511.1 Oryza sativa Japonica Group cDNA clone:J033095I08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612624.10.0PREDICTED: NAC domain-containing protein 92
RefseqXP_015612625.10.0PREDICTED: NAC domain-containing protein 92
SwissprotQ9FLJ22e-83NC100_ARATH; NAC domain-containing protein 100
SwissprotQ9FLR32e-83NAC79_ARATH; NAC domain-containing protein 79
TrEMBLQ0J0J00.0Q0J0J0_ORYSJ; Os09g0497900 protein
STRINGLOC_Os09g32260.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.26e-90NAC domain containing protein 38