PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g31400.1
Common NameLOC4347439, Os09g0490200, OsJ_29834, OSNPB_090490200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family EIL
Protein Properties Length: 612aa    MW: 68283.7 Da    PI: 5.7343
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g31400.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3437.31.4e-133384191353
                       XXXXXXXXXXXXXXXXXXXXXXX...XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
              EIN3   1 eelkkrmwkdqmllkrlkerkkqll.edkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLr 92 
                       e+l +rmwkd+++l+r+ker+ +l  + ++a+++++k + +++qa rkkmsraQDgiLkYMlk mevcna+GfvYgiip+kgkpv+gasd++r
  LOC_Os09g31400.1  38 EDLARRMWKDRIKLRRIKERQDRLAlALQQAELDKSKGKPISDQAMRKKMSRAQDGILKYMLKLMEVCNARGFVYGIIPDKGKPVSGASDNIR 130
                       89*******************99651556666************************************************************* PP

                       XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT CS
              EIN3  93 aWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelg 185
                       aWWkekv+fd+ngpaai+ky+++nl+++++ s+   + +++hsl++lqD+tlgSLLs+lmqhcdppqr++ple+g++pPWWP+G+e+ww +lg
  LOC_Os09g31400.1 131 AWWKEKVKFDKNGPAAIAKYESENLASADAPSS---GIKSQHSLMDLQDATLGSLLSSLMQHCDPPQRKYPLERGTPPPWWPSGNEDWWIALG 220
                       **************************9988888...88******************************************************* PP

                       --TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX.....XXXXXXXX CS
              EIN3 186 lskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss.....slrkqspk 273
                       l++ q  ppykkphdlkk+wkv+vLt vikhmsp++++ir+++r+sk+lqdkm+akes ++l vl++ee+++ ++   +s        + ++ 
  LOC_Os09g31400.1 221 LPRGQI-PPYKKPHDLKKVWKVGVLTGVIKHMSPNFDKIRNHVRKSKCLQDKMTAKESLIWLGVLQREERLVLSIDNGMSevthhGALEYRNG 312
                       *****9.9****************************************************************999888554555433448899 PP

                       XXXXXXXXXXXXXXXXXX.XXXXXXXXXX................................XXXXXXXXXXXXXXXXXXXXX......XXXXX CS
              EIN3 274 vtlsceqkedvegkkeskikhvqavktta................................gfpvvrkrkkkpsesakvsskevsrtcqssqf 334
                        t+s+++++dv+g +e   ++++ +++++                                g++   krk+++++ + ++ +ev    q++  
  LOC_Os09g31400.1 313 DTHSSSNEYDVDGFEEAPLSTSSGDDEQDlspaaqlseehaptrrerakvkrpnqvvpkkaGTKEPPKRKRPRHSVTVIE-QEV----QRADD 400
                       99999*******8888888999999988899999999999*****************************96666666655.545....77777 PP

                       XX.XXXXXXXXXXXXXXXX CS
              EIN3 335 rgsetelifadknsisqne 353
                        +++++++++d+n+++q e
  LOC_Os09g31400.1 401 ASEHSRNMIPDMNRLDQVE 419
                       778899*******999865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.1E-12538288No hitNo description
Gene3DG3DSA:1.10.3180.101.4E-69162294IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.7E-60168291IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042762Biological Processregulation of sulfur metabolic process
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025281anatomypollen
PO:0001015developmental stageK second mitotic division stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 612 aa     Download sequence    Send to blast
MDHLAIIATE LGDSSDFEVE GIQNLTENDV SDEEIEAEDL ARRMWKDRIK LRRIKERQDR  60
LALALQQAEL DKSKGKPISD QAMRKKMSRA QDGILKYMLK LMEVCNARGF VYGIIPDKGK  120
PVSGASDNIR AWWKEKVKFD KNGPAAIAKY ESENLASADA PSSGIKSQHS LMDLQDATLG  180
SLLSSLMQHC DPPQRKYPLE RGTPPPWWPS GNEDWWIALG LPRGQIPPYK KPHDLKKVWK  240
VGVLTGVIKH MSPNFDKIRN HVRKSKCLQD KMTAKESLIW LGVLQREERL VLSIDNGMSE  300
VTHHGALEYR NGDTHSSSNE YDVDGFEEAP LSTSSGDDEQ DLSPAAQLSE EHAPTRRERA  360
KVKRPNQVVP KKAGTKEPPK RKRPRHSVTV IEQEVQRADD ASEHSRNMIP DMNRLDQVEI  420
QGMANQITSF NEEANTSEAL QHRGNTQELA HLPADFNHYG NAQATIATPV SICMRGQAVP  480
YESSDNSRPK TGNIFPQDSD SGFNNMPSSY QTIPPKQPLP LSIMEHHVVP LGIRTPADNS  540
PYSDQIIGSG NSTSVPGDMQ LIDYPFYGEQ DKFAGSSFAG LPLDYISISS PIPDIDDLLL  600
HDDDLMEYLG T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A3e-661682919132ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.878710.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329759970.0
Expression AtlasA3C052-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00649PBM25215497Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g31400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g31400
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1087580.0AC108758.2 Oryza sativa (japonica cultivar-group) chromosome 9 BAC clone OSJNBa0066E19, complete sequence.
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankAK0659790.0AK065979.1 Oryza sativa Japonica Group cDNA clone:J013047J08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612094.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
RefseqXP_015612095.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
SwissprotO231161e-146EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLA3C0520.0A3C052_ORYSJ; Os09g0490200 protein
STRINGLOC_Os09g31400.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5631682
MonocotsOGMP37203779
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-147ETHYLENE-INSENSITIVE3-like 3
Publications ? help Back to Top
  1. Norton GJ,Aitkenhead MJ,Khowaja FS,Whalley WR,Price AH
    A bioinformatic and transcriptomic approach to identifying positional candidate genes without fine mapping: an example using rice root-growth QTLs.
    Genomics, 2008. 92(5): p. 344-52
    [PMID:18755262]