PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g30400.3
Common NameLOC4347399, Os09g0481700, OsJ_29782, OSNPB_090481700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 634aa    MW: 68280.1 Da    PI: 6.0112
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g30400.3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.17.4e-33433491159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC+v+k+ver+++d k v++tYeg+Hnhe
  LOC_Os09g30400.3 433 LDDGYRWRKYGQKVVKGNPNPRSYYKCTHQGCSVRKHVERASHDLKSVITTYEGKHNHE 491
                       59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.9E-37418493IPR003657WRKY domain
SuperFamilySSF1182905.75E-29425493IPR003657WRKY domain
PROSITE profilePS5081137.883428493IPR003657WRKY domain
SMARTSM007743.3E-38433492IPR003657WRKY domain
PfamPF031062.5E-25434491IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 634 aa     Download sequence    Send to blast
MASSSDHGSL MEDWMPPPTP SPRTLMSSFL NEDFVSGSFS NIFSDHESNK PQDQFERNRE  60
LVDLSKEVPS QFARPAFQRD ASLDHSLVSP TQRSNSHGGL AERRAARAGF SVPKIDTSRG  120
GSSTVIRSPV AIPPGLSPTT LLESPVFLYN AMAQPSPTTG TLPFLMASNA KSTIPSATKM  180
DEDCTFGNDT FSFQPHVGSR RPNFSAAEKG PNACHQNQSL SNIHQRESSL QSSFTAVKDI  240
TDEKNIKTKT SDSMFGDNHS SDEQDDETNQ NGENSMPPPN HRSGVPLSHT NDPEVNVLEN  300
RGSQTCHNSA SLWDNAKNDC LQDVQSEVIE TRTAACLPVS TNCDTSIMES QDAVDVSSTL  360
SNEEDDRATH GTASIECNGD GDETDSKRRK LDALTAATAA ITTTSNIDMG AAASRGVREP  420
RVVVQTTSEV DILDDGYRWR KYGQKVVKGN PNPRSYYKCT HQGCSVRKHV ERASHDLKSV  480
ITTYEGKHNH EVPAARNSGH GSSGSGNAPS APQSNGSQRR QEQGQASFSQ FGGAAPFSSF  540
VLPPRNQFGP SASNFPFGMV PPGMAIPMPS LGSLAPAKMA GHPSTMQGYQ GLMIPEGEMK  600
TEPMSQLGFP AVNQSSSSFQ QMMNRPPSFG PQM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-34424494878Probable WRKY transcription factor 4
2lex_A8e-34424494878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.200280.0callus| flower| leaf| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329750960.0
Expression AtlasQ0J0V4-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g30400.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g30400
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1037450.0AK103745.1 Oryza sativa Japonica Group cDNA clone:J033138N11, full insert sequence.
GenBankAK0650780.0AK065078.1 Oryza sativa Japonica Group cDNA clone:J013001K23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612220.10.0PREDICTED: probable WRKY transcription factor 2
RefseqXP_015612221.10.0PREDICTED: probable WRKY transcription factor 2
TrEMBLQ0J0V40.0Q0J0V4_ORYSJ; Os09g0481700 protein
STRINGLOC_Os09g30400.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26440.15e-55WRKY DNA-binding protein 34