PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g29960.1
Common NameLOC9268074, Os09g0475800, P0556A05.8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Dof
Protein Properties Length: 231aa    MW: 23762.4 Da    PI: 9.4724
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g29960.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.85e-384298662
            zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                       +cprC+s++tkfCyynny++sqPr+fCk+CrryWtkGG+lrnvPvGgg+rk+ +ss
  LOC_Os09g29960.1 42 DPCPRCESRDTKFCYYNNYNTSQPRHFCKSCRRYWTKGGSLRNVPVGGGSRKSSTSS 98
                      57**************************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-234190IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.7054296IPR003851Zinc finger, Dof-type
PfamPF027012.6E-324396IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104480IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MQEAGRRPAP QFAGVDLRRP KGYPAAAQLT PAAEEAAAGV GDPCPRCESR DTKFCYYNNY  60
NTSQPRHFCK SCRRYWTKGG SLRNVPVGGG SRKSSTSSSS AAAAAASSSS SPSSPAKSPK  120
RSKNSKRRRV SPPPPQPVPA PPPPTTADAA DVAAPTAPEA TTKKAPEDLT AAAATQPAVA  180
LGLGVADGGG GGKEHLDTSP FEWPSGCDLG PYWPTGVFAD TDPSLFLNLP *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1125129KRRRV
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.812520.0panicle
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ651Z2
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00672SELEXTransfer from GRMZM2G009406Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g29960.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g29960
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankAP0057590.0AP005759.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0556A05.
GenBankKC9967330.0KC996733.1 Oryza sativa transcription factor Dof25 (Dof25) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015610919.11e-164PREDICTED: dof zinc finger protein MNB1A
SwissprotP385647e-57MNB1A_MAIZE; Dof zinc finger protein MNB1A
TrEMBLA0A0E0QSR11e-164A0A0E0QSR1_ORYRU; Uncharacterized protein
TrEMBLQ651Z21e-164Q651Z2_ORYSJ; Os09g0475800 protein
TrEMBLT2CYQ81e-164T2CYQ8_ORYSA; Transcription factor Dof25
STRINGLOC_Os09g29960.11e-163(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.15e-26DOF zinc finger protein 1