PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g29130.1
Common NameLOC4347315, OJ1005_D12.28, Os09g0466400, OsJ_29679, ZHD1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family ZF-HD
Protein Properties Length: 280aa    MW: 29541.1 Da    PI: 7.4822
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g29130.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer98.64.8e-3155108458
       ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                        rY+eClkNhA+ +GghavDGCgEfm++ geegt++al+CaAC+CHRnFHR+e+e
  LOC_Os09g29130.1  55 GRYRECLKNHAVGIGGHAVDGCGEFMAA-GEEGTIDALRCAACNCHRNFHRKESE 108
                       59*************************9.999********************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257743.0E-3736109IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047707.5E-2956107IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015666.9E-3056106IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.64757106IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.13E-20206276IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.3E-33208276IPR009057Homeodomain-like
TIGRFAMsTIGR015651.0E-26215271IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MDFDDHDDGD EEMPPMPVSS SYETPPQHGL AGGGMAPKPP GEIGSRVKGP SCGGGRYREC  60
LKNHAVGIGG HAVDGCGEFM AAGEEGTIDA LRCAACNCHR NFHRKESESL AGEGSPFSPA  120
AVVPYGATPH HQFSPYYRTP AGYLHHHQHH MAAAAAAAAA AAGGYPQRPL ALPSTSHSGR  180
DDGDDLSGMV GPMSAVGPLS GMSLGAGPSG SGSGKKRFRT KFTQEQKDKM LAFAERVGWR  240
IQKHDEAAVQ QFCDEVGVKR HVLKVWMHNN KHTLGKKLP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-292162731875ZF-HD homeobox family protein
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.575660.0flower| leaf| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329934550.0
Expression AtlasQ6YXH5-
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g29130.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g29130
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankAP0056760.0AP005676.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OJ1005_D12.
GenBankAK1082460.0AK108246.1 Oryza sativa Japonica Group cDNA clone:002-140-H06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015610854.10.0PREDICTED: zinc-finger homeodomain protein 1
SwissprotQ6YXH50.0ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLA0A0E0B4180.0A0A0E0B418_9ORYZ; Uncharacterized protein
TrEMBLI1QPM70.0I1QPM7_ORYGL; Uncharacterized protein
STRINGLOC_Os09g29130.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
MonocotsOGMP39503269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.15e-62homeobox protein 22
Publications ? help Back to Top
  1. Hu W,dePamphilis CW,Ma H
    Phylogenetic analysis of the plant-specific zinc finger-homeobox and mini zinc finger gene families.
    J Integr Plant Biol, 2008. 50(8): p. 1031-45
    [PMID:18713354]