PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g28310.1
Common NameB1342C04.26, LOC4347257, Os09g0456200, OSNPB_090456200, P0025H07.45
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 377aa    MW: 39917.2 Da    PI: 9.4665
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g28310.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.56.8e-14297347555
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                       +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++ Nk+L  +   + ++
  LOC_Os09g28310.1 297 RRQRRMIKNRESAARSRARKQAYTLELEAEVQKLKEMNKELERKQADIMEM 347
                       79************************************9998765555444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.7E-11293358IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.657295346IPR004827Basic-leucine zipper domain
PfamPF001701.1E-11297347IPR004827Basic-leucine zipper domain
CDDcd147071.35E-22297349No hitNo description
SuperFamilySSF579596.25E-10297345No hitNo description
Gene3DG3DSA:1.20.5.1703.0E-13297345No hitNo description
PROSITE patternPS000360300315IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MLTDRWGGRR EAMEFGNGGS SSSERRAAAE GATLARQGSV YSLTFDEFQS ALAGGGGGGG  60
GGSGFGKDFG SMNMDELLRS IWTAEESQAM ASASGSAAGV GVAVGAPPTS LQRQGSLTLP  120
RTLSAKTVDE VWRNLVRDEP PPVGAADGGD MPPQRQSTLG EMTLEEFLVR AGVVRENPPA  180
APPPVPPPMP PRPVPVVPKT TAFLGNFPGA NDAGAAALGF APLGMGDPAL GNGLMPRAVP  240
VGLPGAAVAM QTAVNQFDSG DKGNSDLSSP TEPMPYSFEG LVRGRRNGGG VEKVVERRQR  300
RMIKNRESAA RSRARKQAYT LELEAEVQKL KEMNKELERK QADIMEMQKN EVEEMIKDPF  360
GRRKRLCLRR TLTGPW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.1029680.0callus| leaf| panicle| stem| vegetative meristem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329758910.0
Expression AtlasQ67TQ5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g28310.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g28310
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0658730.0AK065873.1 Oryza sativa Japonica Group cDNA clone:J013049N23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612550.10.0PREDICTED: bZIP transcription factor TRAB1-like
SwissprotQ6ZDF31e-107TRAB1_ORYSJ; bZIP transcription factor TRAB1
TrEMBLQ67TQ50.0Q67TQ5_ORYSJ; Os09g0456200 protein
STRINGLOC_Os09g28310.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5401580
MonocotsOGMP70638147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19290.24e-33ABRE binding factor 4