PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g27450.1
Common NameHOX11, LOC4347205, OJ1596_C06.7, Os09g0447000, OsJ_028406
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 363aa    MW: 37833.1 Da    PI: 6.627
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g27450.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.87.7e-18176230256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  LOC_Os09g27450.1 176 RKKLRLSKEQSAFLEESFKEHSTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 230
                       788899***********************************************98 PP

2HD-ZIP_I/II127.17.6e-41176266192
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                       +kk+rlskeq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  LOC_Os09g27450.1 176 RKKLRLSKEQSAFLEESFKEHSTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELAELR-ALK 266
                       69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.4E-18161226IPR009057Homeodomain-like
SuperFamilySSF466892.01E-18164233IPR009057Homeodomain-like
PROSITE profilePS5007117.07172232IPR001356Homeobox domain
SMARTSM003891.1E-15174236IPR001356Homeobox domain
PfamPF000462.5E-15176230IPR001356Homeobox domain
CDDcd000861.79E-16176233No hitNo description
PROSITE patternPS000270207230IPR017970Homeobox, conserved site
SMARTSM003401.4E-24232275IPR003106Leucine zipper, homeobox-associated
PfamPF021831.4E-10232266IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025281anatomypollen
PO:0001015developmental stageK second mitotic division stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MELGLSLGEA MADAGRELVL GLGMGRREEA AEAGRRDHEV RRELEFGSMS SRCGGSSPEP  60
TVRLTLLPMV PGLGLPWPPP PPPSSESRHL EASTRGFDVN RPPSSGGGGG GGGAEEEQDD  120
VAGAALSSSP NNSAGSFPMD DFSGHGLGGN DAAPGGGGGD RSCSRASDED DGGSARKKLR  180
LSKEQSAFLE ESFKEHSTLN PKQKLALAKQ LNLRPRQVEV WFQNRRARTK LKQTEVDCEY  240
LKRCCETLTE ENRRLQKELA ELRALKTVHP FYMHLPATTL SMCPSCERVA SNSAPATASS  300
AATSSTAAPP AAPSSGGIAA TSSSAAAAAA PDHRPSSFAA LFSSPRGFPL SVAPQAQPPT  360
SS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224232RRARTKLKQ
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1482833840.0
Expression AtlasQ67UE2-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g27450.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g27450
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankAP0055750.0AP005575.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OJ1596_C06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611029.10.0PREDICTED: homeobox-leucine zipper protein HOX11
SwissprotQ67UE20.0HOX11_ORYSJ; Homeobox-leucine zipper protein HOX11
TrEMBLA0A0E0QS440.0A0A0E0QS44_ORYRU; Uncharacterized protein
STRINGLOC_Os09g27450.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19616156
MonocotsOGMP52093363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.15e-63homeobox from Arabidopsis thaliana
Publications ? help Back to Top
  1. Agalou A, et al.
    A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members.
    Plant Mol. Biol., 2008. 66(1-2): p. 87-103
    [PMID:17999151]