PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g26170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 378aa    MW: 40137.7 Da    PI: 6.5067
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g26170.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.51.7e-141462148
                      TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                      +g+W +eEd  l+ +v  +G+g +W + ++++g++R++k+c++rw++yl
  LOC_Os09g26170.1 14 KGPWAPEEDAALKAYVDAHGTGgNWIALPHKIGLNRCGKSCRLRWLNYL 62
                      79*********************************************97 PP

2Myb_DNA-binding39.61.2e-1269111246
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       g +T++Ed l+  +    G++ W+tIa+ ++ gRt++++k++w++
  LOC_Os09g26170.1  69 GGFTEDEDRLICSLYIAIGSR-WATIAAQLP-GRTDNDIKNYWNS 111
                       569******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.757962IPR017930Myb domain
SuperFamilySSF466898.55E-2612109IPR009057Homeodomain-like
SMARTSM007178.1E-111364IPR001005SANT/Myb domain
PfamPF002493.3E-131462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-221569IPR009057Homeodomain-like
CDDcd001671.25E-71662No hitNo description
PROSITE profilePS5129420.43263117IPR017930Myb domain
SMARTSM007176.7E-1167115IPR001005SANT/Myb domain
PfamPF002496.2E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-2170117IPR009057Homeodomain-like
CDDcd001674.89E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MGRAPCCDKA TVKKGPWAPE EDAALKAYVD AHGTGGNWIA LPHKIGLNRC GKSCRLRWLN  60
YLRPNIRHGG FTEDEDRLIC SLYIAIGSRW ATIAAQLPGR TDNDIKNYWN SKLKRRLLGG  120
GRRPRGAPPR LVLAGPGPAV TAAATSRNAM AASAIERMQL SVRLRRLEAA APPPPQPFTF  180
YGSNNLAAPP WQQPISPAAG GSSEMPRRLH HHHPSGAAAT SSYSGLISSW PSSRSHIIHD  240
AWLDASSTPP LSTTSMGDAA TTTTTAGGES SSSTPTVSTA TTPFIGGSID MDDEIDMLLQ  300
QIRCFDENGD DGDDDADQRL IVGDEAAAGA ENYLRALIDE AAANGGDVGV GSWSSCSTPG  360
VDSVFHEYAQ LDYGQYN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-26141177108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g26170.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g26170
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankAP0057470.0AP005747.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OSJNBa0039E17.
GenBankAP0056860.0AP005686.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OSJNBa0016E03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015610955.10.0PREDICTED: transcription factor MYB30-like
SwissprotQ9FKL21e-77MYB36_ARATH; Transcription factor MYB36
TrEMBLA2Z1I40.0A2Z1I4_ORYSI; Putative uncharacterized protein
STRINGLOC_Os09g26170.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP132652632
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.15e-71myb domain protein 36