PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g25040.1
Common NameOs09g0417400, P0014G10.34
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bHLH
Protein Properties Length: 500aa    MW: 49079.8 Da    PI: 7.0636
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g25040.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH35.61.7e-11261309555
                       HHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
               HLH   5 hnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                       h+++Er RR+ri +++  L+el+P+a  ++    +Ka++L + ++Y+k Lq
  LOC_Os09g25040.1 261 HSIAERLRRERIAERMKALQELVPNA--NKLMQTDKASMLDEIIDYVKFLQ 309
                       99***********************7..48888*****************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474599.68E-16254319IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000831.34E-12254313No hitNo description
PROSITE profilePS5088816.787256308IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.108.7E-15260314IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000108.1E-9261309IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003539.9E-13262314IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0048767Biological Processroot hair elongation
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 500 aa     Download sequence    Send to blast
MAAAAAAGQI SLDDLRNGGG VAANAGGGGG VHDDFLDQML SSLPPSAWPD LAAGKAAEDD  60
AEGMHHHHHQ QQQQFGGPYD ESAMLASRLR QHQISGGGGG GGGGAAAVKQ MVLQQLADLR  120
QGHHMMLQGL GGRSPAGGGG GGGDGGLLLP LTLGSGGSGG DVQALLKAAA ANSAGGGDAG  180
GVYGGGFAGS LHQQQQHFQP HPQTAPTIPT QSFGGGGGGG GGGTASGGGA AQPQAGAAGG  240
GAPAPPRQRV RARRGQATDP HSIAERLRRE RIAERMKALQ ELVPNANKLM QTDKASMLDE  300
IIDYVKFLQL QVKASTYTKL LIHVLSMSRL GGAAAVAPLV ADMSSEGRGG GAANGGAPAA  360
AGSDSLTVTE QQVAKLMEED MGTAMQYLQG KGLCLMPISL ASAISSATCH LRPPVVAAAQ  420
QFPAGLGAAA AAAHHHQLSA AAAAAAMRGH LPGLNADGSV PASPSMSVLT AQSAMANGGG  480
GAADGEGSQL KDAASVSKP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130138GGRSPAGGG
2265270RLRRER
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.596580.0leaf
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ6EPZ6
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g25040.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g25040
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankAP0057840.0AP005784.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0014G10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015610784.10.0PREDICTED: transcription factor UNE12 isoform X1
SwissprotQ9ZUG95e-75BH066_ARATH; Transcription factor bHLH66
TrEMBLQ6EPZ60.0Q6EPZ6_ORYSJ; BHLH transcription factor PTF1-like protein
STRINGLOC_Os09g25040.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5816313
MonocotsOGMP141937118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24260.11e-43LJRHL1-like 1