PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g24800.1
Common NameOs09g0414300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 322aa    MW: 33068.8 Da    PI: 8.1246
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g24800.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding538.1e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd+ lv +++++G g+W++++   g+ R+ k+c++rw +yl
  LOC_Os09g24800.1 14 KGPWTPEEDLMLVSYIQEHGAGNWRAVPTNTGLMRCSKSCRLRWTNYL 61
                      79********************************************97 PP

2Myb_DNA-binding52.51.2e-1667112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++T++E++l+v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  LOC_Os09g24800.1  67 RGNFTEQEEKLIVHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-23564IPR009057Homeodomain-like
PROSITE profilePS5129417.476961IPR017930Myb domain
SuperFamilySSF466892.36E-3011108IPR009057Homeodomain-like
SMARTSM007172.9E-131363IPR001005SANT/Myb domain
PfamPF002499.6E-161461IPR001005SANT/Myb domain
CDDcd001679.67E-111661No hitNo description
PROSITE profilePS5129425.11662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2465117IPR009057Homeodomain-like
SMARTSM007171.6E-1666114IPR001005SANT/Myb domain
PfamPF002491.5E-1567112IPR001005SANT/Myb domain
CDDcd001672.25E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MGRPPCCDKV GVKKGPWTPE EDLMLVSYIQ EHGAGNWRAV PTNTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF TEQEEKLIVH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKKKLKKMQ  120
AAGGGEDSGA ASEGGGGRGD GDGGGKSVKA AAPKGQWERR LQTDIHTARQ ALRDALSLDH  180
PDPSPATAAA AATPAGSSAA YASSADNIAR LLQGWMRPGG GGGGNGKGPE ASGSTSTTAT  240
TQQQPQCSGE GAASASASAS QSGAAAAATA QTPECSTETS KMATGGGAGG PAPAFSMLES  300
WLLDDGGMGL MDVVPLGDPS F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-26141164105C-Myb DNA-Binding Domain
1msf_C3e-26141164105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.480850.0leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154791460.0
Expression AtlasQ0J1T4-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g24800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g24800
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankAP0056360.0AP005636.2 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0707C02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015610978.10.0PREDICTED: myb-related protein 306
SwissprotP813921e-107MYB06_ANTMA; Myb-related protein 306
TrEMBLQ0J1T40.0Q0J1T4_ORYSJ; Os09g0414300 protein
STRINGLOC_Os09g24800.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.16e-92myb domain protein 94