PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os09g23620.1
Common NameLOC4346997, Os09g0401000, OsJ_29287, OSNPB_090401000, P0435D08.47, P0650H04.29
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 280aa    MW: 30935.9 Da    PI: 4.8113
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os09g23620.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.81.4e-141461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd++lv      G  +W+++++  g+ R++k+c++rw +yl
  LOC_Os09g23620.1 14 KGPWTAEEDQKLVSFLLGNGQCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                      79******************************99************97 PP

2Myb_DNA-binding53.74.8e-1770111447
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        ++ E++  +d+++qlG++ W++Ia++++ gRt++++k++w+++
  LOC_Os09g23620.1  70 LSETEEKTVIDLHEQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 111
                       5899***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-19563IPR009057Homeodomain-like
PROSITE profilePS5129413.848961IPR017930Myb domain
SuperFamilySSF466893.29E-2611108IPR009057Homeodomain-like
SMARTSM007178.0E-111363IPR001005SANT/Myb domain
PfamPF002494.1E-131461IPR001005SANT/Myb domain
PROSITE profilePS5129426.54962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2464116IPR009057Homeodomain-like
SMARTSM007174.4E-1566114IPR001005SANT/Myb domain
PfamPF002495.2E-1570111IPR001005SANT/Myb domain
CDDcd001676.21E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDQKLVSFLL GNGQCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SETEEKTVID LHEQLGNRWS KIASHLPGRT DNEIKNHWNT HIKKKLRKMG  120
IDPVTHKPLY PAPPLADGGS PEQKVPEEEE EVEEKSSAAV ESSTSTCAGH DVFCTDEVPM  180
LHLDDIVLPP PCDVVGDTAG SPAESSSTST SSSGGGGIDE EWLLPIMEWP ESMYLMGLDD  240
VDMVTTAAPA MATSWEFEDP FNAYQRIALF DHHHELTWA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121165108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.33910.0flower| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO19452820.0
Expression AtlasQ6ES55-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os09g23620.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs09g23620
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankY113510.0Y11351.1 O.sativa mRNA for myb factor, 1402 bp.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015610941.10.0PREDICTED: protein ODORANT1
SwissprotQ50EX63e-84ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0E0QR620.0A0A0E0QR62_ORYRU; Uncharacterized protein
TrEMBLO041100.0O04110_ORYSA; Myb factor
TrEMBLQ6ES550.0Q6ES55_ORYSJ; Os09g0401000 protein
STRINGLOC_Os09g23620.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.11e-86myb domain protein 20
Publications ? help Back to Top
  1. NA
    The electronic Plant Gene Register.
    Plant Physiol., 1997. 114(1): p. 395-6
    [PMID:9159957]